KEGG   Takifugu rubripes (torafugu): 101070424Help
Entry
101070424         CDS       T02386                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
  KO
K02358  elongation factor Tu
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tru03012]
    101070424
   03029 Mitochondrial biogenesis [BR:tru03029]
    101070424
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101070424
Translation factors [BR:tru03012]
 Eukaryotic Type
  Elongation factors
   101070424
 Prokaryotic Type
   101070424
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101070424
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101070424
  Exosomal proteins of breast cancer cells
   101070424
  Exosomal proteins of colorectal cancer cells
   101070424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 101070424
NCBI-ProteinID: XP_003964534
LinkDB All DBs
Position
5
AA seq 446 aa AA seqDB search
MAALVGLRACLSALQLSTPNLLHSSFKICAVPLSRRTFAAEAKKTYSRDKPHVNIGTIGH
VDHGKTTLTAAITKVLADAGGANYKKYEDIDNAPEEKARGITINASHVEYSTANRHYAHT
DCPGHADYVKNMITGTSQMDGCILVVAATDGQMPQTREHLLLARQIGVEHVVVFINKADA
VEDKEMVELVEIEIRELLTEFGYDGENTPVVIGSALCALENREPELGMNAVLKLLEIVDA
YVPLPKRELDKPFLLPIEGVYSIAGRGTVVSGTLERGLIKKGDEAELVGHNRSFKAVITG
IEMFHKSLDRAEAGDNLGALVRGLKREDVRRGMVMCKPGSIKPHQKVQAQVYILSKEEGG
RHKPFVTNFMPLMFSLTWDMACRVTLPDGKEMVMPGDDTNLTLTLRQPMVLEKGQRFTLR
DGNKTIGTGLVTEILTYTDEDHHNWG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcgtgggtttgcgtgcatgtttgtctgcccttcagctttccacaccaaac
ctgctgcatagctcctttaagatttgtgctgtgccattgagtcgccggacctttgctgca
gaggcaaagaagacatacagtagggacaagccccatgtgaacattggaacaattggccat
gttgaccatggcaagacaacgctgactgcagccattactaaagtgcttgctgatgctggt
ggcgcaaactataaaaagtacgaggacatagataacgcccctgaagaaaaggccagagga
atcaccatcaatgcttctcatgttgaatactccacagccaataggcattatgctcacaca
gactgccctggtcatgctgactacgtcaagaacatgattacaggcacatcccagatggat
ggctgcatcctggtggtggcagccacagacggtcagatgcctcagaccagagagcacctt
ctcctggccaggcagatcggtgtggagcatgtggtggtcttcattaacaaggctgatgct
gtggaggacaaggagatggtggagttggtggaaatcgagatccgagagttgctcacggag
ttcggatatgatggcgagaacacacctgtcgtaataggctcggctctctgcgctctggag
aatcgagagcctgagcttggtatgaatgcagtgttgaaactcttggagattgtggatgct
tatgttcctctgcccaaaagagagctggataaaccattccttctccccattgaaggggtt
tattccattgcaggaaggggcacagtggtgtcaggcactttggagagagggctcatcaaa
aaaggagacgaggctgaattggtgggacacaatcgcagcttcaaggctgtgattacaggt
attgagatgttccacaagtcccttgaccgggcagaagcaggagataatctgggcgctttg
gttcgtggcctgaagagagaagatgtgaggagagggatggtgatgtgcaaacccggatcc
atcaaacctcaccagaaagtccaagcacaggtgtatattctgagtaaggaagagggagga
agacacaaaccttttgtcaccaacttcatgcctcttatgttctctctcacctgggacatg
gcctgcagggtcactctgccagatggcaaggaaatggtaatgccaggagacgacaccaac
ttgacgctgacgcttcgccaaccgatggttctggagaaaggccagcggttcactttgaga
gatggaaacaagaccatcggcacgggcctggtcacagaaatcctgacttatacggatgaa
gaccatcacaactggggctga

DBGET integrated database retrieval system