KEGG   Takifugu rubripes (torafugu): 101070634Help
Entry
101070634         CDS       T02386                                 

Gene name
suv39h1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101070634 (suv39h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tru03036]
    101070634 (suv39h1)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101070634 (suv39h1)
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101070634 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101070634 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101070634
NCBI-ProteinID: XP_011618075
UniProt: H2SU12
LinkDB All DBs
Position
Un
AA seq 416 aa AA seqDB search
MAENLKEAAAAGCSVPCKMPPEQLEDLCRRERLHCRDLGVSRANINHYEVEFLCDYKKTK
DTELYMVKWKGYPESENSWEPKKNLKCPKLMKQFHLDLDQMLRRNKRHSVPKKLDKETVS
FLTQKAKLHLSLQRWEAHLNQTRNHPGRIFVRNEVDLEGPPKNFTYINNYRVGPGIVLDE
MAVGCECSSCWEEPVNGCCPGASLHRMAYNDRGQVRIRPGKPIYECNSQCKCGPECPNRV
VQKGIQFDLCIFKTDNGRGWGVRTLQHIKKNTFVMEYVGEIISTDEAERRGHVYDRQGST
YLFDLDYVEDVYTVDAAHQGNVSHFVNHSCNPNLQVFNVFVDNIDERLPRIALFSTRSIR
AGEELTFDYKMQIDPVDTESTKMDSSFGLAGLTSSPKKRIRVECRCGSDSCRKYLF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagaagcggctgctgctgggtgcagcgtcccctgcaagatgccc
ccggagcagctggaggacctgtgccgcagggagaggctccactgtcgggacctcggcgtc
agcagagccaacatcaaccactatgaggtggaattcctttgtgactacaagaagaccaaa
gacacagagttatatatggtgaagtggaagggatatcccgagtctgaaaactcctgggaa
cccaagaaaaacttaaaatgcccaaaactaatgaagcagttccatctggacctggatcag
atgttaaggcgcaacaagagacacagcgttcccaaaaaactggataaggagacggtgtcc
ttcttgacccagaaagccaaactccacctgagtcttcagcgctgggaagctcacttgaat
cagactcgcaaccatccgggccgcattttcgtccggaatgaggtggacctggagggcccg
ccaaagaacttcacgtacatcaacaactacagagtgggtccgggcatcgtgctggacgag
atggcggtgggctgcgagtgtagcagctgctgggaggagcccgtcaacggctgctgcccc
ggcgcctccctccaccgcatggcttacaacgaccggggccaggtccggatccggcccggg
aagcccatatatgagtgcaactcgcagtgcaaatgtggccccgagtgtccaaacagggtg
gtccaaaagggaatccagttcgacctgtgtatctttaagactgacaacggtcgaggctgg
ggggtccgcactctgcagcacatcaagaagaacacgtttgtcatggagtatgtgggagag
atcatctccacggatgaagcagagaggagaggccacgtgtacgaccgccaaggctccacc
tacctgtttgacctggactacgtagaagacgtgtacacggtggatgcagctcaccaaggc
aacgtctcccacttcgtcaaccacagttgtaatcccaacctgcaggtatttaatgtgttc
gttgacaacatcgacgagcggctccccagaatcgccttgttttccacgcgcagtattcgt
gcaggagaggagctgaccttcgattacaagatgcagattgacccagttgacactgaaagc
accaaaatggactccagttttggtctcgcgggtctcacgagttctccgaaaaagaggatt
cgggtggaatgtcgatgtggctcggactcctgtcggaaatacctgttctga

DBGET integrated database retrieval system