KEGG   Takifugu rubripes (torafugu): 101070968
Entry
101070968         CDS       T02386                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X2
  KO
K04692  signal transducer and activator of transcription 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04068  FoxO signaling pathway
tru04217  Necroptosis
tru04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101070968 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101070968 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101070968 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101070968 (stat3)
Transcription factors [BR:tru03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101070968 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 AP1AR
Other DBs
NCBI-GeneID: 101070968
NCBI-ProteinID: XP_003964844
Ensembl: ENSTRUG00000015348
UniProt: A0A3B5K909
LinkDB
Position
5
AA seq 764 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAS
TAAQDGQAANPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQASATRQKMAQLEQMLSALDQLRRQIVTELGGLLTAMDYVQKNLTNEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVASIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMVGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERALLS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAPEQEMGDPTGTIQPYLKTKFICVTPTN
SGNTSDLFPMSPRTLDSLMHNDADANPGHLDSLTLEMEVASSPM
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccagatatctggagcaactctaccac
ttgtatagtgacagtttccccatggaactacgacagttccttgccccctggattgaaagt
caagattgggcttatgcagcaaacaaggagtcacatgctacactggtcttccacaacctt
ttgggcgaaatagaccagcaatatagccgtttcctgcaggagaacaatgtactctaccag
cacaatctgcgaaggattaaacagcatctacaaagcaagtacttggaaaagcccatggaa
attgctcgcattgtcgcccgctgtctgtgggaggagcaaaggctgctacagaccgcctcc
acggcggcacaggatggccaagctgcaaatcccagtgggacagttgtgactgagaagcag
cagatcctggagcataaccttcaggacatcaggaagcgggtgcaggatatggaacagaag
atgaaaatgcttgaaaacctgcaggatgactttgatttcaattacaagacattgaaaagc
caaggagagctgtcccaggacctcaatggcaacagccaggcatctgcaaccagacagaag
atggctcagcttgagcaaatgttgagtgccctagaccagctcaggaggcaaatagtcaca
gagttgggaggtttgctgactgccatggactatgtacagaagaacttgacaaacgaagaa
ctagccgactggaagaggcggcaacagattgcctgcataggaggtccacctaacatctgc
ttggatcgccttgaaacatggatcacgtcattggcagagtctcagctccagattcgtcag
cagatcaagaagctggaggaactgcagcagaaggtgtcctacaaaggagaccccatcatt
cagcaccgacccgcccttgaggaaaagatcgtggacttgttcaggaacctcatgaagagt
gcttttgtggtggaaaggcagccttgtatgcccatgcatccagacagacctctggtcatc
aaaacaggagtgcagttcacaaacaaagtcaggttgttggtcaagtttccagaactcaac
tatcagttgaaaattaaagtttgtattgacaaagaatctggagatgtggcttcaattcga
ggatcacggaagttcaatatcctcggcaccaacactaaagtgatgaacatggaagagtcg
aacaatggcagcctgtcggcagagtttaaacatttgaccctgagagaacagaggtgcggt
aatggcggccgcacaaacagcgatgcctcattgattgtcacagaggagctccatctcatc
acttttgagacagaagtctatcaccaagggctaaagatcgatttagagactcattcccta
cccgtggtggtcatctcaaacatctgccagatgcccaacgcttgggcctccattctttgg
tacaacatgctcaccaaccacccaaagaatgtcaacttcttcactaagcccccagtgggg
acgtgggaccaggtagccgaggtgctgagctggcagttttcctccaccaccaagagaggc
ttgacaattgaacagcttaccacactggctgagaaactattagggccgtgtgtaaattac
tctggctgtcagatcacttgggcaaagttttgtaaggaaaacatggttggcaaaggcttc
tccttctgggtgtggctggacaatattattgacctggtgaagaaatatatcctggcatta
tggaatgaagggtatattatgggatttatcagcaaggagagagagagggcactgcttagt
ccaaaacctcctgggaccttcctgctgcgctttagcgagagcagtaaagaagggggcatt
acgttcacatgggtagagaaagacataagtgggaagacccagatccagtcggtggagcct
tacacaaaacagcaactcaacaacatgtcttttgccgacataatcatgggctacaagatt
atggatgctactaatatcctagtttctccactcgtgtacctctaccccgacatccccaaa
gaggaagcgtttgggaaatactgcagaccagaagcagctcctgaacaagagatgggggac
cccacaggaacaattcagccctacctaaagacaaagttcatctgtgttacccccacaaac
tctgggaacacgagcgacctgttccccatgtcacctcgcacacttgactctctgatgcac
aatgacgcggatgctaatccaggacatttggattctctgactttagaaatggaggtagca
tcatcaccgatgtga

DBGET integrated database retrieval system