KEGG   Takifugu rubripes (torafugu): 101071202Help
Entry
101071202         CDS       T02386                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00590  Arachidonic acid metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101071202
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101071202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101071202
NCBI-ProteinID: XP_003965327
LinkDB All DBs
Position
6
AA seq 600 aa AA seqDB search
MRYSVFVAFWALLLLLPRHSAYQADAEATSNPVNPCCYLPCQHWGVCVRYGVDKYECDCT
RTGYFGENCTIPEFWTRVRLLLKPSPDVAHYILTHFHWLWDIINNTFLRDILMRLVITVR
SNLVPYPPTYNSKYGYLNWESMSNLSYYTRLLPPVPEDCPTPMGVKGREELPDPELLVER
LLKRRTFRPDPQGTNLMFAFFAQHFTHQFFKTYNRMGLGFTKALDHGVGAGHIYGDTLDR
QLQLRLHKDGKLKYQVVDGEVYPPTVKDAPIRMNYPSWIPPEKTFAIGQEMFGIIPGLTL
YATLWLREHNRVCDILKAEHPTWDDEQLFQTSRLIIIGETIKIVIEEYVQQLSGYLLNLK
FDPAMLFSTQFQYGNRIALEFSQLYHWHPLMPDRFLIDGDEVPYEQFLYNTSFLFHYGPD
KMVDAFSRQPAGQIGGGHNVPAVLTDVAVRTMTESRHLRLQSFNEYRKRFNLQPYTSFRH
FADNEEIARELEEFYGDIDALEYYPGLMLEKTRTGAIFGESMVEMGAPYSLKGLLGNPIC
SPEYWKPSTFGGKVGFDLVNSATLKNLVCHNTKTCPYVAFSVPKEAQSQSPGSKGRADEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagatactctgttttcgttgcgttctgggcgcttcttctcctgctgccgcgacattct
gcgtaccaggctgatgccgaggctacctcaaacccagtcaatccctgctgttatttgccc
tgtcagcactggggcgtgtgtgtgagatacggcgtggataaatacgagtgcgactgcact
cgcaccggctacttcggggagaactgcaccatccccgagttctggaccagagtgcggctg
ttgttaaagcccagcccagatgtggcccattacatcctcactcacttccactggctctgg
gacatcatcaacaacaccttcctgcgggacattctcatgcgtttggtgataacagtgagg
tcgaacttggtgccctatcctccgacctataactccaaatatggatacctcaactgggaa
tccatgtctaacctgagctactacactcgcctcctgcccccagtgcctgaagactgtcct
acacccatgggggtcaaaggcagggaagaactgcctgaccctgagctgctggttgagagg
ctgctgaagaggagaacgttcaggcctgacccccagggcaccaacctcatgtttgccttc
tttgctcagcacttcacccaccagtttttcaagacctacaaccgcatgggtctgggtttc
accaaggcgttggaccacggggtgggtgcaggacacatttacggagacaccctggaccgc
cagctccagctaaggcttcataaagatggaaaactcaagtatcaggtcgttgacggtgag
gtgtacccccccactgtaaaggacgcacccatcaggatgaactacccatcctggatccct
cctgagaaaacgtttgccatcgggcaggaaatgtttggaatcatcccaggtttgacgctg
tacgccaccctgtggctcagggagcacaaccgggtctgcgacatcctgaaggccgaacac
cccacctgggacgacgagcagctcttccagacatcccgtctcatcatcatcggagagaca
ataaagatagtgatagaggaatacgtgcagcagctcagcggataccttctgaatctgaag
ttcgacccggcgatgctgtttagcacgcagttccagtacgggaaccgcatcgctctggag
ttcagccagctttaccactggcacccactgatgcctgacagattcctcattgatggcgat
gaggtgccgtatgaacaattcctctacaacacttcattcctctttcactatggcccggat
aaaatggtggatgccttctctcggcagcctgccggccagattggcggtggccataatgtg
cctgctgtgctgaccgatgtggctgtgaggaccatgacggagtcgcgtcatctccgcctg
cagtccttcaacgaataccggaaacgttttaacctccagccctacacatccttcagacat
tttgctgataacgaagaaatagcccgtgagcttgaagagttctatggggacattgacgct
ctagaatattaccctggtttgatgttggagaaaacaagaacgggtgccatttttggagag
agcatggtggagatgggtgccccctactccctcaaaggactcctgggaaatcccatatgt
tctcctgaatactggaagcccagcacatttggaggcaaagttggctttgacctagtcaat
tctgccacattaaagaatttagtctgtcataatacaaagacgtgcccttatgtggcattt
agtgttccaaaggaggcccagtcacaaagccctggcagcaaaggaagagcggatgagcta
tga

DBGET integrated database retrieval system