KEGG   Takifugu rubripes (torafugu): 101071398Help
Entry
101071398         CDS       T02386                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101071398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 101071398
NCBI-ProteinID: XP_003975980
UniProt: H2VAN1
LinkDB All DBs
Position
Un
AA seq 742 aa AA seqDB search
MSDPAPVVDPSPAPAAPSGPRPKVTNRGRTAVAVASSNSESTEVPEFESFVALSPRGFPP
LTDYLDIVAVDMMSQSDGVNKQQHRTMFYNSNYLIVRRGQEFHVKLTFNRPYNPKEDKFA
LEFVIGANPDYSKGTYIPVFPNKERQSRWAGRIADSSNNDVTVGITPLANCIVGKYHMYI
AVMTPFGIRRTRKDPVRDLYILFNPWSPADDVFLDDEPERQECVMNEMGIIYHGAYDDIA
ERQWNYGQFNYGVLDACLYIMDRSEMPITNRGDPIKVTRKASAMLNSRDDDGVLVGNWSG
DYTYGVAPTSWTGSTEILLTYASSRMPVSYAQCWVYAAVFNTFLRCLGIPSRVVTNYYSA
HDNDGNLKTDIILDENGKIDRSRTRDSIWNYHCWNECYMTRPDLPFGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGEMCYPFDAAFVFAEVNSDVVFYSRGKDGAMQPVRVNQTHVG
RMVLTKAPGATTRRDITSQYKFPEGTSEERTVLEKAEGFGCHREKSRPPEADVDLVLPTL
EVPVGQDFELSLEFVNRSDQRRVVEAYISGNVVFYTGVTSAEFMLRDPTVTMKPNETVKE
TVVVESKKYMKHLVEQANLHFIITGKVKETGQIVTAMKVVALHNPKLSVKVSGENRVSEE
MMATVEFTNPFSFALADVYIRMEGPGVMMPTYKYYSLIPNGSSLTWTEMFVPQRAGATRV
FATLDCPALRQVQGEVSLTIKP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacccagctcccgtcgtggacccctcccctgcccccgcggctccctccggaccg
cgtcccaaggtcaccaatcgcggccgcaccgccgtcgccgtcgccagctccaattccgaa
tccacggaagtgcccgagtttgagtcctttgtcgccctgagcccccgaggctttccgcct
ctgacagattatcttgacatcgtggctgtggacatgatgtcacagtcagacggggtgaac
aagcagcagcaccggaccatgttttacaactccaactatctcatcgtgcgtcgggggcag
gagttccatgtcaagctcaccttcaatcgcccctacaatcccaaagaggacaagttcgcc
ctggagtttgtcatcggtgccaaccctgactacagcaagggcacctacatccccgtcttt
cccaacaaggagcgccagtcccgctgggcaggccggatcgcagacagttccaacaacgac
gtcaccgtcggcatcactcctttggcaaattgcatcgtggggaagtatcacatgtacatc
gcggtgatgacgcccttcggcatccgccggaccagaaaggaccccgtccgtgacctctac
atcctgtttaacccgtggtccccagccgacgacgtgttcctggatgacgagccagagcgg
caggaatgcgtgatgaatgagatgggcatcatctaccacggtgcatatgacgacatagct
gaaaggcaatggaactatggccagtttaactatggggttctggatgcctgcctgtacatc
atggacagatctgaaatgcccatcacaaacagaggagacccaattaaagtgaccagaaag
gcctctgctatgctcaattctcgagacgacgacggcgtgttggtggggaactggagtggc
gactacacctacggggtggcgccaacttcctggactggcagcacagaaatcctgctgacc
tacgccagcagcaggatgcccgtcagctacgctcagtgctgggtctacgccgccgtcttc
aacaccttcctgcgctgcctggggatcccatcgcgggtcgtaaccaactactactccgca
cacgacaatgacggaaacctgaaaaccgacatcatcctggacgagaacggcaagattgac
cgcagccgcacgagagactccatctggaactaccactgctggaacgaatgctacatgaca
aggccagacctccccttcggcttcggggggtggcaggtcgtggacgcgactccccaggaa
acaagcgacggcatgtacagatgcggtcctgcgtcggtccaggccatcaagcacggggaa
atgtgctacccttttgatgccgcctttgtgttcgcagaagtcaacagcgacgtggtgttt
tactcccgaggtaaagacggggccatgcagccggtcagagtcaatcagacccacgtgggc
cgtatggtgttgaccaaagctcctggagccacgacccggcgtgacatcacaagtcaatac
aagtttcctgaaggcactagcgaagagcggaccgttttggaaaaagcggaggggttcggc
tgtcatcgcgagaagtcccgcccccctgaggccgacgtggacctggtcctccctaccctg
gaggtccccgttggccaagacttcgaactgagcctggagttcgtaaaccgcagcgaccag
cggcgggtcgtcgaggcctacatcagcgggaacgtggtgttctacaccggcgtcaccagc
gccgagttcatgctgcgggacccaacagtgaccatgaagcccaacgaaaccgtgaaggag
acggtggtggtggagtcaaagaagtacatgaagcacctggtggaacaggccaaccttcat
ttcatcatcactgggaaggtcaaggagaccggacagatcgtcaccgccatgaaggtggtc
gccctgcacaatcccaagctcagcgtcaaggtgtctggcgagaacagagtgagtgaagag
atgatggcgaccgtggagttcaccaaccccttctccttcgccctggcggacgtctacatt
cgcatggaggggcccggggtcatgatgcccacgtacaagtattacagcctgatccccaat
ggatcatctctgacctggaccgagatgttcgtgccgcagagggccggcgccacccgtgtg
ttcgccactctggactgtcctgccctcaggcaggtccagggggaggtgtccctcaccatc
aagccctga

DBGET integrated database retrieval system