KEGG   Takifugu rubripes (torafugu): 101071664
Entry
101071664         CDS       T02386                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101071664 (cdkn1b)
   04068 FoxO signaling pathway
    101071664 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101071664 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101071664
NCBI-ProteinID: XP_003967535
Ensembl: ENSTRUG00000024873
UniProt: A0A3B5KDR9
LinkDB
Position
9
AA seq 184 aa
MSDVRLSNGSPTLERTDPRVPDHPKPSACRNLFGSVDHEKLKRDFKRHMQEMEKDASAKW
GFDFANDTPLPNSRFDWELVDCKDVPNFYCAQTRREKGVCPAGNNNVDLNGNHNCVVAPC
EDGDRSDGQMECTEQCPGQRKRPACHDPSAQNKRSHTSTDEVICPSLSQSAEHTPRKKSP
KRQT
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactatcaaacgggagcccgacgctggagaggacggatccccgagtg
ccggatcacccgaaaccgtccgcttgcagaaacctcttcggctcggtggatcacgaaaag
ttaaagagggattttaagagacacatgcaggagatggagaaggatgcctccgccaagtgg
ggcttcgactttgccaatgacacgccgctgcccaacagcaggttcgactgggaattagtg
gattgcaaagacgtcccgaatttctactgcgcccagacgcggagagagaagggcgtctgc
cctgctgggaataacaatgtggatctaaatgggaatcataactgtgttgtggctccgtgc
gaagacggcgacaggtccgacggtcagatggagtgcacggagcagtgtcccgggcagagg
aagagacctgcatgccacgacccctcggcccaaaataagaggtcgcacaccagcacagat
gaggttatttgtccaagcctaagccagtctgcagaacacacacccagaaagaaaagtccc
aagaggcaaacgtga

DBGET integrated database retrieval system