KEGG   Takifugu rubripes (torafugu): 101071679
Entry
101071679         CDS       T02386                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101071679 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101071679 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tru03310]
    101071679 (nr3c1)
Transcription factors [BR:tru03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101071679 (nr3c1)
Nuclear receptors [BR:tru03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101071679 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 101071679
NCBI-ProteinID: XP_003970808
Ensembl: ENSTRUG00000006399
LinkDB
Position
15
AA seq 765 aa
MDQGGLKRNGNRDGSLTFGETGGRLGGDMGDPAGSLLQPDMHLPGIGSLPSSAVSSTEQG
GSKDPVELGSFFLSDMKEGKGRMQKQQDIDQFSMESNLLKQSIPDSIITTSDTSVLGNLP
LPDLFPQHIKQQETFSLDKDLETYNTNTVVGQSVLESNSNLLLEDAVIWKDLELSCSLPE
ISDFELDTEVAHLDNILHQCRSSRAPISPFPNDIRSALDRGNNCPSLNGTDNSVQKLSQQ
QQQQPGPLLSSVTIKEEKDPVPSFIHIRTPEVVKQEKGDGDTFCDAACLQSAVSSRYEGR
TMASLPVGLGPSSDYNYTANLASVVDLQDQKPFSLYPNLPVSRERWSTGSRYGESAGTQR
ADDGVQSIAVLGSFPSSFSSSSPRTADTVGSPVLSQPKPSGQTHKICLVCSDEASGCHYG
VVTCGSCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLRAG
MNLDARKNKKIIKMKMQHPTNINMPVPVIPRSMSQLVPTMLSVLKAIEPEIIYSGYDSTL
PDTSSRLMSTLNRLGGQQVISAVKWAKALPGFRNLDLDDQMTLLQCSWLFLMSFGLGWRS
YEQCNGSMLCFAPDLVINKERMKLPFMNDQCEQMLKICDEFVRLQVSYEEYLCMKVLLLL
STVPKDGLKSQTVFDEIRMMYIKELGKAIVKREENASQNWRRFYKLTKLLDSMQEMVEGL
LQFCFYTFVNKTLSIEFPEMLVEIITDQIPKFKDGSIKPLLFHQK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatcagggtggattgaaacgcaacggaaatcgagatggcagcctgacatttggggaa
acgggaggaagattaggtggtgacatgggcgacccagctggttcacttctccagcctgac
atgcacctgcccggcattgggtctctgccctcatctgcggtgtcctcaaccgaacaaggt
gggtccaaagatcccgtggagcttggaagtttcttcttgtcagacatgaaggagggcaaa
gggaggatgcagaagcaacaggatattgatcagttcagcatggagagcaacctgttgaag
cagagcattcctgactctatcatcaccacctccgacacctctgtcctggggaacctgccc
ctgcctgacctttttccccagcacatcaagcagcaggagactttttctctggataaagac
ctggaaacatacaacacaaacacggttgttggccaaagcgttttggagagcaacagcaat
ctcctgctggaggacgcagtgatttggaaagacctggaactttcctgctctctgccagaa
atcagtgattttgaattggatacagaggtggcacacttggataacatcctgcaccagtgc
aggagcagcagggctccgataagcccttttcccaacgacataagatctgccttggatagg
ggaaacaactgtccaagcttgaatggaactgacaactcagttcagaaactgtctcagcag
cagcagcagcagcctggacccctcctctccagcgtcacgatcaaggaagaaaaggatccg
gtcccctctttcattcacatccgaacccctgaagtggtcaagcaggagaaaggggatggt
gatactttctgtgacgcagcgtgtctccagagtgccgtgagctccaggtacgaaggccgc
accatggcctccctgccagtgggacttggcccgagttctgactataactacacagcaaac
ttggcctcggtggtggatcttcaggaccagaagccctttagcttgtatcccaacctgcct
gtgtccagggagaggtggagcactgggagtaggtatggggaatcggctggaacacagaga
gcggatgacggtgtccaatccatcgcagtgctgggatcttttcctagcagcttctccagc
tcgtcacccagaactgcagatactgttgggtcaccggtcctgagccagcccaagcccagc
gggcagacccacaagatctgtctggtgtgctccgatgaggcctcgggatgccactatgga
gtcgttacctgtgggagctgcaaggtgttcttcaagagggccgtagaaggatggagagca
cgacaaaacacagatggacagcacaactacctgtgcgctgggaggaatgactgcatcatc
gataagatccggaggaagaactgcccagcctgtcgcttcaggaagtgccttcgggctggg
atgaacttggatgcgagaaaaaacaagaagataataaagatgaaaatgcagcatcccacc
aacatcaacatgcctgttccagtcatccccaggagcatgtcccagcttgtgcccaccatg
ctgtctgtactcaaggccatcgagcctgagatcatctactcgggctacgacagcacgctg
ccagatacctcgtcgcggctcatgagcaccctgaatagattaggggggcaacaggtcatc
tctgctgtcaagtgggccaaggcactgccaggtttccgcaaccttgatctggatgaccag
atgactttgctgcagtgctcctggctctttctcatgtccttcggtcttggttggcgctcg
tatgaacagtgcaacggcagcatgctctgcttcgctcccgacctggtcatcaacaaggaa
cgcatgaagctgcccttcatgaatgaccagtgtgagcaaatgctgaagatctgtgacgag
tttgtgaggttgcaggtgtcctatgaggagtacctctgcatgaaggtccttttactgctc
agcacagtaccaaaagatggtctgaagagccagacggtgttcgatgagatcaggatgatg
tacatcaaggagctgggaaaagccattgtcaagagagaggagaatgccagccagaactgg
aggcgtttctacaagctgaccaaattactggactccatgcaggagatggtagagggtctt
ctccaattctgtttctacacctttgtgaataaaaccctcagcatagaattcccggagatg
ctggtggagatcatcacagaccagataccaaaattcaaagacggaagcatcaaacctcta
cttttccaccagaaatga

DBGET integrated database retrieval system