KEGG   Takifugu rubripes (torafugu): 101072062
Entry
101072062         CDS       T02386                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
tru  Takifugu rubripes (torafugu)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 101072062
NCBI-ProteinID: XP_003973343
Ensembl: ENSTRUG00000014055
LinkDB
Position
19
AA seq 357 aa
MSKCELIELKDLSVNDPIELAAPAPRRAPPVHPGQPSHFQVVRLVGDSVSIEASRRHTGD
AWDGHDFQPYNHTYLTWCDLCGEFIWGLYKQSLRCNNCSYTCHYRCQPFIQLDCSTNGKL
LTEEEETLAESFERDTNVDEQIDWSKHEMTVTEIQHKVKEYNSQTNSNLNMVFNRDGTYT
GFVKVHFQLVRPISLPPHESVRCNPGEARQDRWMRRRTSFYLPKDAAKHLHISSQTRVRE
VIEALLNKFTVVDNPAKFALFEHTERQSQVCMRKLSNDECPLFLRLCAGPSEKVMSLVLK
ENETGDINWDAFSFPELCNFLRILKREEEEHVRQIVRRYALARDMMKQAMARITTPA
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatcgagctcaaggacctcagcgttaacgaccccatcgagctg
gctgcacctgcaccacgtagggccccacctgtacacccgggtcagccaagccactttcag
gtagtgcgtctggttggggacagcgtcagcatcgaggcgtcgcggcgccacaccggggat
gcctgggatggtcacgacttccaaccctacaatcacacctacctcacgtggtgcgacctt
tgtggagaattcatctggggtctttacaagcaaagtttgcgctgtaacaattgcagttac
acttgtcactatcgctgccagccgttcatccagctggactgcagcacaaatgggaaatta
ttaacagaagaggaggagacattagctgaatcctttgaaagggacacaaatgtggatgaa
cagattgattggagtaaacatgagatgacggtcactgaaattcaacacaaggttaaagag
tacaattcgcagaccaacagcaatctcaacatggtgtttaatagagacgggacctacaca
ggcttcgtcaaggtccattttcagttagtccggcccatctccctccctccacacgaaagc
gtgcgttgcaatccaggtgaagcccggcaggacaggtggatgagacggagaacttctttc
tacctccccaaagacgcggccaagcaccttcacataagctcccagacacgcgtacgagag
gtgattgaggccttgctcaacaaatttaccgtggtggacaacccagccaagtttgctttg
tttgaacacactgagagacaaagtcaagtatgcatgcggaaactgagcaatgacgaatgt
cccctcttcctgcgcttgtgtgccggccccagtgaaaaagtgatgagccttgttttaaaa
gagaatgaaacaggggacattaattgggacgcatttagttttcctgagctgtgcaacttc
ctgagaatcctgaagcgtgaggaggaggaacatgtgcgtcagatcgtgcgacgctatgcc
ctagcaagagacatgatgaagcaggccatggccaggattacaactccagcttga

DBGET integrated database retrieval system