KEGG   Takifugu rubripes (torafugu): 101072718Help
Entry
101072718         CDS       T02386                                 

Definition
(RefSeq) N-lysine methyltransferase SMYD2-B
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00310  Lysine degradation
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101072718
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tru03036]
    101072718
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     101072718
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     101072718
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101072718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12 Ribonuc_2-5A
Motif
Other DBs
NCBI-GeneID: 101072718
NCBI-ProteinID: XP_003971775
Ensembl: ENSTRUG00000013934
LinkDB All DBs
Position
16
AA seq 432 aa AA seqDB search
MTGIMEGVERFDSPGKGRGLRVTRAFQVGELLLSSQAYSYVLSVKERGEHCESCFTRKKS
LARCGKCKKAFYCDVKCQKGDWAMHRLECSAMNAFGEKWCPSEITRLVARILTKKKMQKD
RCASEKLLLLGEMQSHTEDMDNERRETMEADVAGLHQFFSKHLEIPGHKDLLTLFSQVAC
NGFTIEDEELSHLGTAVYPDVALINHSCRPSVIVTYSGTSAHVRALRDMKPGDEVLISYI
DVLYPTEDRNNRLRESYYFTCQCEECESRSMDQAKLKARKRSEPIEPEAISNMVRYARKC
IREFRVFKNTSPASTLLEMCEQSLDEMGAVFDDSNVYMLHMMYQAMGVCLYMQDPDGAIR
YGEKIAKYYRKLYPAYSLNLSSLYLKLGRLYFGMERNAECIGMLKKAKAIMEVTHGKEHF
YLTELDRQMKEM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatggagggtgtggagaggttcgacagcccggggaaaggacgaggtctc
cgcgtcaccagagcgtttcaggtcggggagctgctgctctccagccaggcgtattcatac
gtgctgtcagtgaaggagaggggggagcactgtgagagctgcttcaccaggaagaaaagc
ctggcgagatgtgggaagtgcaagaaagccttttactgcgacgtgaaatgccagaaagga
gactgggccatgcacaggctggagtgctctgccatgaacgctttcggggagaaatggtgc
ccgtcggagataacccggctggtggcgcggatcctcaccaagaagaaaatgcagaaggac
agatgtgcgtctgagaagctgctgctcctcggagagatgcagtcgcacacggaggacatg
gacaacgagagacgggagacgatggaggcggacgttgcaggactgcatcagtttttctcg
aagcacctggagatcccgggccacaaagaccttctcacgctcttttcacaggttgcgtgc
aacgggttcactatagaagacgaggagctgtcccacctgggcactgcagtctaccccgac
gtcgctctgatcaaccacagctgccggcccagcgtcatcgtcacctacagcggcacgtcg
gcccacgttcgggcgctgcgggacatgaaacctggagatgaagtgctcatcagctacatc
gacgtcctctatccaacggaagaccgcaacaacagactgcgagagtcgtattatttcacc
tgtcagtgtgaggagtgcgaaagccggtccatggaccaggcaaaattgaaagcacgtaag
cgcagcgagcccatcgagccggaggccatcagcaacatggtgcgctacgccaggaaatgc
atcagggagttcagagtcttcaaaaacacctcccccgctagcacgctactggagatgtgt
gagcagagcctggacgagatgggagccgtcttcgacgattccaacgtctacatgctccac
atgatgtaccaggccatgggggtgtgtctctacatgcaggacccagacggagccatcaga
tacggcgagaagatcgccaagtattacagaaagctgtatccagcctactctctgaatctg
tcctccctgtacctgaagttagggagactctacttcggaatggagaggaatgctgagtgc
atcggaatgctgaagaaggcaaaggcaattatggaggtgacacacgggaaggagcatttt
tacctgacggaactggacagacagatgaaggaaatgtga

DBGET integrated database retrieval system