KEGG   Takifugu rubripes (torafugu): 101073153
Entry
101073153         CDS       T02386                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04141  Protein processing in endoplasmic reticulum
tru04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tru00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101073153
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101073153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101073153
Transcription factors [BR:tru03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101073153
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GAS YabA Med21
Other DBs
NCBI-GeneID: 101073153
NCBI-ProteinID: XP_029700568
LinkDB
Position
12
AA seq 693 aa
MSTDLLSDLDSRFFADNLLTSEDWDACLYQCESLDEGEDRDACRGLKYEPLFENDLVLTL
DPDNPTSPWQHLGDNPLTGDNQVSTSEMTITQPLPMEMLFQVKAEPASPSSSSGSDCSVS
APDSQIIVKSENPPTPPYMYGDVLSPPLGAMEVTIATTSVPSPQRAELPTRISPILSGVQ
TQAGVLPSSATLKANTILSTKPPIQPRPVCVASLPVTQTPAAAKTLILQGLHPMEQSQPV
VLSQSVCLGSAPAIVKMEPVSPSMPQHCSGTTSPSASKPIVPAMVKTSISNGSSDIDMKV
LKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQDLRQRLTGKEGSD
SINNKRTVCVMAILLFMTFSFGPVSISDRRLTDLQEGIVSYTGRHLLEIEQQQQQQEETV
APPDREEKSETEEEGAEELPESYQFRNLSDVLSDMKDLVLQDIDRYFTSSDCRQFNRSES
LRLADELRGWVHRHQIDRKKSGGKPKLAKKAKITQKAQLRKTNVSRYLPVQTHRSIESQL
QVLPGPEVTYADFLDAIDRREDTFYVVSFRRDHLLLPAITHNKTSRPKMSLVMPAMSVNE
SLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPTPSHPASHHGSQHRHGNHSSS
SSSSSSSPSSSVRPHFPTRRRTAEYLISQSEGI
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgagtacggatttactctctgatttggacagtcggttcttcgctgataatctcctgacg
agcgaagattgggatgcctgtctctaccagtgtgaaagcctcgatgagggggaggacaga
gatgcctgccggggcctgaaatatgagccgctgtttgagaacgaccttgttcttacactt
gatcctgacaaccccacttcaccatggcaacacctaggtgacaacccacttacaggggat
aatcaggtatcaacaagtgaaatgaccattacacagcccctgccaatggagatgttgttt
caggtgaaagcagaaccagcttctccatcatcctcctcggggtctgattgctcggtctct
gctccagactcacagatcattgttaaaagtgaaaatcccccaactccaccttatatgtat
ggagatgtgttgtcacctccactgggggccatggaggtcaccattgctacaacgtccgtc
ccttcgcctcagagagcagagctaccgacacgaatctcaccgatcctcagcggggtccag
acccaggctggagttctgccaagttccgccacgttgaaggcaaacacaattctgagtacc
aaaccccccatccaacccagaccagtgtgtgttgcctccctccctgtcacccagacccct
gcggcagctaagaccctcatcctgcagggtctgcaccccatggaacagagccaacccgtt
gtcttgtcccagtcggtctgcctcggttcagctccagccattgtcaaaatggagccggtc
tctcccagcatgccccagcactgctctggcaccacgtccccgtctgcaagcaagcccatt
gtccccgcaatggtaaagacctcaatcagcaacggctccagtgacattgatatgaaggta
ctgaagcgacagcagagaatgataaaaaaccgtgagtcagcctgtcagtcaagaaagaag
aagaaagagtacctgcagaacctggaagcccagctcagggaggcccagcaggagaatgag
cggctgcggagggagaaccaggacctgaggcagagactgactgggaaagagggcagcgat
tcaataaacaacaagaggacggtgtgtgtcatggccatcctgctgttcatgaccttcagc
tttggacctgtgagcatctcagacaggagactgacagacttacaggaaggtattgtgtca
tatacggggcgccatctgctggagattgagcagcagcagcagcagcaggaggagactgtg
gcacctccagacagggaggagaagtcagagacagaggaggaaggagcagaggagcttcct
gagtcctaccagttcaggaacctgagcgatgtgctgagtgacatgaaggacttggtgctg
caggacatcgatcgttacttcacctcctcagactgcagacagttcaaccgctccgagtcc
ctgaggctggctgacgagctcagaggctgggtccaccggcaccagattgacaggaagaaa
tctggaggaaaacccaagctggccaagaaggccaagatcacccagaaagctcagctgagg
aagacaaacgtctccagatatctgccggtccagactcaccgctccatagaaagtcagctg
caggttcttcctggccctgaggtcacctacgccgacttcctggatgctattgatcgcaga
gaggataccttttacgttgtctcttttagacgggaccacctgcttctgcccgccatcacc
cataacaaaaccagccggcccaaaatgtccttagtgatgccagccatgtctgtcaatgag
agtctctacaattcctctcaaggttatgagatgatgatgcaggtcgactgtgaggtcatg
gacacccgcattgttcccatcaagtcttctgccgtcccaccatctctccgtgacccgact
ccttctcaccctgcctcccatcacggctcccagcatcgccatggcaaccacagctcctct
tcttcatcatcgtcctcctcgccctcttcttctgtgaggccgcattttcccaccagacga
cgaacagcagagtatttgatcagccagtccgaaggaatctga

DBGET integrated database retrieval system