KEGG   Takifugu rubripes (torafugu): 101073312Help
Entry
101073312         CDS       T02386                                 

Gene name
h6pd
Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00030  Pentose phosphate pathway
tru01100  Metabolic pathways
tru01200  Carbon metabolism
Module
tru_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tru_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101073312 (h6pd)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     101073312 (h6pd)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     101073312 (h6pd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C Glucosamine_iso G6PD_N DUF5617
Motif
Other DBs
NCBI-GeneID: 101073312
NCBI-ProteinID: XP_011612258
Ensembl: ENSTRUG00000011967
UniProt: H2U023
LinkDB All DBs
Position
19
AA seq 791 aa AA seqDB search
MSVTLFLLLATLCVSGAKGEDRKDAQTAGHVSVVIVGGTGDLAKKYLWQGFFSLYVDNVG
KGNTFSFICGGLSPADGATPVFFEILKGLSCSEDVSQERCALLKDQFMRLSQYRQLKTLE
QYQDLDKHIEQELSQEGMTEAGRLFYLSVPAFAYADIAEKINSSCRPKSGAWLRVVLEKP
FGHDLRSAQVLTSQLESSLKDEEMFRIDHYLGKQAVAKILPFRMDNRRFLDPIWNKHHIE
RVEIVVKETLDVKGRIAYYDQYGAIRDMLQNHGTEIMTLLTMRLPKNQSSSEEILQNKLQ
ILSSLQPLGKNQAVVGQYQTYNSEVQQELNKTTDYLSFTPTFAAVLAYVDEARYEGVPIL
LISGKKLDERVGYARILFKNDVFCVQNHHSVHCKPKQIVFHFGHGSLGYPAILVSKNLFK
PVLEDGGWKEVKEQADVSVLGLPLSDYHVLSPAEPREAYSELISHIFAGRKNNFIRAESL
LASWGLWTPVLGSLADTFPRVYPGGAENGAVLDVYVKGNELRYYTEVTIINNEATDGAAA
SGFQVMQGKFRRAEMVSAWAEELVERLAQDMQEAAEAAVRDGGVFHLALSGGSTPLALFH
RLSHYHSSFPWRETHIWMVDERCVPLSEPDSNFHTLHEHLLRHLRIPYYNIHPMPVQINQ
RLCVEEDGGALLYEKEVNKLVNGSSFHFVLLGVGYDGHTASLFPGNKVEVNGESLVALTE
SPNKPHQRMSLTFGAINRAHMVALLVMGKGKHETITQLSRVKDQPEKWPITGVKPVSGRL
VWYIDNDALLG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaccctgttcctgcttctggccactttgtgtgtgtctggagcaaaaggcgag
gacaggaaggatgcccagacagccggccatgtttcagtggtgattgtgggaggcactggt
gacctggcgaagaagtacctgtggcagggtttcttcagcctgtacgtagacaatgtcggc
aaaggaaacaccttttccttcatctgcggaggactttcaccggctgacggtgccactccg
gtcttctttgagatcctgaagggactgtcctgctcagaagatgtatcgcaagagcgctgt
gccctgctgaaagaccagtttatgcggctctcccagtaccggcagctgaagaccttagag
cagtaccaggatctggataaacacattgagcaagagcttagtcaagaaggaatgacggag
gcagggagactcttctacctctctgtacctgcctttgcctacgcagacatcgctgagaag
atcaacagcagctgcaggccaaaaagtggggcctggctgagggtggtccttgagaaacct
tttggacacgacctcaggagcgcacaggttcttacctcacagctggagagctctttgaag
gatgaagaaatgttcagaatagaccactacttgggaaagcaggcagttgcaaagatactg
ccatttaggatggacaaccgcaggtttctggatcccatctggaacaagcaccacatcgag
cgggtggagatcgtagtgaaagagaccctggatgtcaaaggtcggatcgcctactatgac
cagtacggcgcgatccgagatatgctgcagaaccacgggaccgagatcatgaccctgctg
accatgagacttcccaagaaccagagcagcagtgaagagatccttcagaacaagctccag
atcctcagttccctgcagcctcttgggaagaatcaagctgtggtgggccagtaccagacg
tacaactcagaggttcagcaggagctcaacaagacaacagattacctcagcttcactccc
acatttgccgccgtgttggcgtacgtggacgaggcccgctacgaaggcgtgcccatactt
ttgatttccgggaagaaactcgatgaacgggtgggatatgcgcgcatcctctttaaaaac
gacgtcttctgcgttcagaaccaccacagcgtccactgcaagccaaaacagatagtgttc
cactttggccatggcagcctgggatacccagcaatcctcgtgagtaagaacctgttcaag
ccagttttagaggacggcgggtggaaggaggtgaaggagcaggcagatgtcagcgtcctg
ggtctgcctctttcagactatcacgtgctatccccagcagagccgcgggaggcttattcc
gaacttatctctcacatttttgccggacgcaagaacaattttatccgagcggaaagcctc
ctggcgtcctggggcctgtggactccagttctcggtagcctcgctgacacttttccccgc
gtctaccccgggggggcagagaacggggccgtgctggatgtttacgtgaaagggaatgaa
ctcaggtattacaccgaagtgacgataatcaacaacgaagcaacggacggcgcggcggcc
agcggcttccaggtgatgcaaggcaagttccgcagggctgagatggtatctgcttgggcg
gaggagctggtggagcggctcgcccaggacatgcaggaagcagcagaggcagcggtgagg
gacggtggcgtcttccatctggccctctctggtgggtccacaccactggctctgttccac
aggttgtcccactaccactcctcctttccctggagggaaacccacatatggatggtggac
gagcggtgtgtgccgctcagcgaaccagactcgaacttccacaccctgcacgagcacctg
ctgcggcacctgaggatcccctactacaacatccaccccatgcccgtgcagatcaaccag
cgcctgtgtgtggaggaggacggtggggcgctgctgtacgagaaagaggtcaacaagttg
gtcaacggctccagctttcacttcgtgctgctgggagtcggctacgacggccacaccgct
tccctctttcccggtaataaagttgaggtcaacggcgagagtctggtggcgctcaccgag
agccccaataagccccaccagcgcatgagcctcaccttcggcgccattaaccgcgcacac
atggtcgctcttttggtgatgggtaagggaaagcacgagaccatcacccagttgagtcgc
gtcaaggaccaaccggagaaatggcccatcaccggggtgaagcccgtcagcggcaggctt
gtgtggtacatagataacgatgcacttttagggtag

DBGET integrated database retrieval system