KEGG   Takifugu rubripes (torafugu): 101073543
Entry
101073543         CDS       T02386                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04020  Calcium signaling pathway
tru04144  Endocytosis
tru04510  Focal adhesion
tru04540  Gap junction
tru04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101073543 (pdgfra)
   04020 Calcium signaling pathway
    101073543 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101073543 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101073543 (pdgfra)
   04540 Gap junction
    101073543 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101073543 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101073543 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tru04090]
    101073543 (pdgfra)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101073543 (pdgfra)
Protein kinases [BR:tru01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101073543 (pdgfra)
CD molecules [BR:tru04090]
 Proteins
  101073543 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 101073543
NCBI-ProteinID: XP_003973981
Ensembl: ENSTRUG00000015076
LinkDB
Position
20
AA seq 1472 aa
MDGTKTYVVFGVILVVSVTSGLSPPTIVSNEEEFILLPSSILNVSCTGKRNVVWAEPLPT
NSFVFPGYYTATLFIYNATVKNTGYYTCTYVHLEAEQEGQPQEANEAEIYVFVPDAQVPF
VPETPDNLVVTMDPSGVPISCRVSDPHSHVTLRSVSTGDEMSAFYDGRIGFFGMLSPGQY
QCETFVNGRIFRSDIYTVEDEASTETEDFEVDVRASEETVRAGQPFNVTCTGPPGPGFQQ
QWLHPKSQAAEAVQVKETFPDRVVYVLSVPRAVSQDSGTYECSITHVMSGAVRAGGAAVA
IFEENSIVALDHSGILTSEFVSLLEETEFTILINAYPPPKVHWLKDAESLSENDFILTKT
SHLEGNRYQSILILRQPLLKDSGNYTIMATSGSQTAQFSFTLKMKAPRPSMFPPSSAPLL
LPQLEELVVPLHTAFTLTCQGEATIAWDVPLDVPEKTQEDNSGLFVTTISVDSASAMHTG
YYRCFYRRNATEDADEAMQSIYVYVPDPDVPFVPLVVPFGNHVLSDHEEMEIQCRVSDPS
ANVTLINVDTQQPVPCMYDSKRGALGVFTAGTYVCKAVVNGAEHYSEDYIVHGWIGGSGL
HVELTAKHTVLLVGDTITVNCLAQGSEILEDHWKYPGKVANRAIKTVHENKKDQEILYTL
TVPQASVKDTGIYSCSITDVVTNMSQTKQIAIRVYASEFMSIQPKFGEYESAELDEVCEF
RAEITSFPTASVTWFKDSVPLSNVTAEISTSLQKLSETSYMSVLTLIRAKEEDSGNYTMR
VKNGDQSRTVSLILEVKVPAVIVDLMDIHHGSATGQSVVCITRGQPTPLVEWFVCKNIKH
CANDTSSWVPLPVNSTEVTMDSRFDEDNNLETQVIFGHLENTLAVRCLARNEMAAVSREI
KLVSNGPHPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIY
VDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR
SSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRESFL
NPKPEKSNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEISNASK
YSDLQGSNYDHPPSQKGSNDGEMDQLLSDNMSEGLTTNDLLSFTYQVAKGMEFLASKNCV
HRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTL
SDVWSYGILLWEIFSLGGTPYPGMIVDSSFYNKIKSGYRMSKPEHAPQDVYDMMMKCWNS
EPEKRPSFLGLSDTIASLLPSSYKRHYERVNHEFLKSDHPAVTRVCVDNDDAYIGITYKN
QGKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDEEYGKRNRHSSQTSEESAIETGSSSS
TFAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggatgggacaaagacgtatgtcgtctttggggtcattctggtggtttcagtcacctct
ggactgtcacctccaaccattgtctccaatgaggaggagttcatcctgctgcccagttcc
attttgaacgtcagctgcaccggtaaaaggaacgtggtctgggccgagcctctgccgaca
aactccttcgttttccccggatactacacggcgacgctgttcatttacaacgccacggtg
aaaaacaccggctattacacctgcacatatgtacatctggaggctgaacaggaaggacaa
ccacaggaggccaatgaggcagaaatctatgtgtttgtgccagacgcacaggttcctttc
gtccctgagacgcccgataacttggtggtcaccatggaccccagcggagtgcccatctcc
tgccgtgtttccgacccccactcccacgtcaccctgaggagcgtgtccacgggagacgag
atgtctgccttctacgacggcaggattggctttttcggaatgctgtcgccgggccagtac
cagtgtgagacgttcgtgaacggccggattttcaggagcgacatttacacggtggaggat
gaggcctctacagagacagaagactttgaggtggacgtgagggccagcgaggagacggtg
agagcaggccagcccttcaacgtcacctgcaccggcccgccaggacccggcttccagcag
cagtggcttcaccctaaatcacaggctgcggaggcggttcaggtgaaagagacttttccg
gatcgggtcgtctacgtcctcagcgtcccgcgagccgtctctcaggacagcggcacctat
gagtgctccatcacccatgtcatgagcggagcggtcagagccggtggggcggccgtcgcc
atctttgaggagaactctattgtggcgctggaccacagcgggattctgacctcagagttc
gtcagccttctggaggagacagagttcaccatcctcatcaacgcctacccaccccccaaa
gtgcactggctaaaagatgccgagtcgctgtcggaaaatgacttcattctcaccaaaacc
agccacctcgaaggaaatcggtatcaaagcatcctgatcctacggcagccgctgctgaag
gacagcgggaactacaccatcatggccacgagtggctctcagacggctcagttctccttc
accctcaaaatgaaagctcccagaccgtcgatgttcccgccctcctcggctccgttgctg
ctgccacagttggaggagctggtggttcccctccacaccgccttcactttaacatgtcag
ggggaggcgacaatagcctgggacgtgccgctggacgtgccggagaagacgcaggaggac
aacagcggcctcttcgtcaccactatcagcgtggactccgccagcgccatgcacaccggc
tactacaggtgcttctacagaagaaacgccacggaggacgcggacgaagcgatgcagagt
atctatgtctacgtgccagaccctgacgtcccctttgttccgttggtggtgcctttcggc
aaccacgtcctgtccgaccacgaggagatggagatccagtgccgggtgtcggatcccagc
gccaacgtcacgctgataaatgtcgacacccagcagcccgtgccttgcatgtacgatagc
aagaggggcgctctgggcgtgttcacggctgggacgtatgtctgcaaggccgtggtcaac
ggagcggagcactacagcgaggattacatcgtccatggctggatagggggctccgggctg
cacgttgagctgacggccaaacatacggttctgctggtgggagacaccatcacggtcaat
tgtttggctcagggatctgagattttggaggaccactggaaatatcccgggaaagtggct
aatcgtgctattaagacggttcacgagaacaaaaaggatcaggagattctttacaccctc
acagtcccgcaggcttccgtcaaggacactggcatttactcctgttccatcaccgatgta
gtaaccaacatgagtcagaccaagcagatcgccattcgcgtttacgcgagcgagttcatg
tccatccagccaaagttcggagagtacgaatcggccgagctggacgaggtctgcgagttc
agggccgagatcacctctttcccgaccgctagcgtcacgtggtttaaagacagcgtcccg
ctcagcaacgtgacggcggagatttctaccagcctccagaagctcagcgagaccagctac
atgagtgtcctgaccctgatccgagccaaggaggaggacagcgggaactacaccatgcgg
gtgaagaacggagatcagagtcgcaccgtcagcctgatcctggaggttaaagtgccggca
gtcatcgtggacctgatggacatccaccacggctcagctacaggccagtccgtggtgtgc
atcaccagaggtcagcccactcctctggtggagtggttcgtctgcaagaacatcaagcac
tgcgccaatgacacctcatcctgggtgcccctccccgtcaactccacggaggtcaccatg
gattcgcgcttcgacgaggacaataatctggagacccaggtcatatttgggcacctggag
aacacgctggcggtgcgctgcctggccaggaacgaaatggccgccgtcagcagggagatc
aagctggtgtccaatggccctcatccagagctgactgtcgcggcggctgtgttggtgctc
ctggtcattgtcatcatctcactcattgtcttggttgtgatctggaaacagaaaccgcga
tatgaaatccgctggagggtcatcgagtctgtaagcccggatggacacgagtacatctac
gtggatccaatgcagcttccctacgactccagatgggagttcccccgggacagacttgtg
ttgggtcgcatcctgggctctggagcctttgggaaagtggtggagggcaccgcctatggg
ctcagccgctctcagcctgtcatgaaggtggcagtaaagatgctcaaacccacagcgcgc
tccagcgaaaaacaggccctgatgtctgagctgaagatcatgacccacctgggaccgcac
ctcaacattgttaacctgctgggcgcctgcaccaagtcaggccccatatacatcatcact
gagtactgtttctacggcgatctggtcaactacctgcacaagaaccgggagagcttcctc
aacccgaagccagagaagagcaacaagaaagagttggacatttttggaatcaaccccgcg
gacgagagcagcagaagttatgtgatcctgtccttcgagagcaaaggcgactacatggac
atgaagcaggccgacaacactcagtatgtgcccatgctggagataagcaatgcctccaag
tactctgacctccagggctccaactacgaccacccgccctcgcagaaaggatcaaatgac
ggcgaaatggatcaactgctgtcggacaacatgagcgagggcctcaccaccaatgacctg
ctgagtttcacctaccaggtggctaaaggaatggagttcctggcttcaaaaaattgtgtc
caccgagatctggccgccaggaacgtcctgctctctcagggcaagatagtgaagatctgc
gactttggactggcgcgagacatcatgcatgacaacaactacgtctccaaaggaagcacg
ttcctaccagtgaagtggatggctcccgagagcattttcgacaacctgtacaccacgctg
agcgacgtctggtcgtacggcatcctgctgtgggagatattctctttaggcggcacgcca
tacccaggtatgattgtggattccagcttctataacaagatcaagagtggctacaggatg
tccaaaccagagcacgcgcctcaggatgtgtatgacatgatgatgaagtgctggaacagc
gagccggagaagaggccctctttcctgggtctcagtgacaccatcgcctctttgctgccc
tccagctacaagcggcattacgagagggtgaaccacgagttcctgaagagtgaccaccct
gccgtgacccgagtgtgcgtagataacgatgacgcctacatcgggatcacctacaaaaac
cagggaaagttaaaggacagggaaagtggatttgatgagcagcggctcagctccgacagt
ggctacatcatccccctgcctgacctggaccccatttctgatgaggaatacgggaagagg
aacagacacagctctcaaacgtccgaggagagcgccatcgagacggggtccagcagctcc
actttcgcaaagcgcgagggcgagacgctggaggacatcacgcttttggacgagatgtgt
ctggactgtagtgacctggtggaggacagctttctgtga

DBGET integrated database retrieval system