KEGG   Takifugu rubripes (torafugu): 101073743
Entry
101073743         CDS       T02386                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04137  Mitophagy - animal
tru04210  Apoptosis
tru04218  Cellular senescence
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04623  Cytosolic DNA-sensing pathway
tru04625  C-type lectin receptor signaling pathway
tru04920  Adipocytokine signaling pathway
tru05132  Salmonella infection
tru05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101073743
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101073743
  09143 Cell growth and death
   04210 Apoptosis
    101073743
   04218 Cellular senescence
    101073743
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101073743
   04621 NOD-like receptor signaling pathway
    101073743
   04622 RIG-I-like receptor signaling pathway
    101073743
   04623 Cytosolic DNA-sensing pathway
    101073743
   04625 C-type lectin receptor signaling pathway
    101073743
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101073743
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101073743
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101073743
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101073743
Transcription factors [BR:tru03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101073743
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101073743
NCBI-ProteinID: XP_011604759
Ensembl: ENSTRUG00000008758
LinkDB
Position
8
AA seq 680 aa
MEGGYGWSRSSLGTASPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIK
VHNYSGPLRVRISLVTKNAPHKPHPHELVGKDCKHGYYEADLQERRIHSFPNLGIQCVKK
KDVTEAITCRLQTNNNPFNIPEPKVWEEEFDLNSVRLCFQASFTQPTGERIQLTPVVSQP
IYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTFSQA
DVHRQVAIVFRTPPYRDANISEPIRVKMQLRRPSDREVSEPVDFQYLPADPDEYRLSEKR
KRTGDVFHGLKLGPLLSTVTIPHDRRHISPRRTVTAKPPATVPAQTAPPIAGAAKPQPSY
SFSQQMQGFSVHPKPDSSPSATATHQAWRIMESLNLGPQPKAAAVSSFPVTQAPSSSAAS
SSSVTTPAINQEFSTVNQSDLDEFFPNISAGVSQEPSSSQGGVASSQLGGSFSLQPFRVD
PTLMDDNMSDFPSFEHQGQNTLASLNIDDFVDFLNPGLMTECGNGASMACHPPAPPSSSS
AAQNSTAADAANMPGSTWMTYPHPIANLLQNEAMMDVATNANHQPAVLDDYDVLTSADED
RLISILTVEPRPALCRDIPPKDLLQLLLAALKTGQASPVKMICKRLNVAPQKRPHSSPDA
SVPFVPYEREPPGASAAGQR
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggagggcgggtatggatggagccggagctcgctcggcacagcgagtcccttcatagag
atcatcgagcagcccaagcagagggggatgaggttcaggtacaagtgcgagggccgttca
gctgggagcattcctggagagaagagcaacgacaccactaaaacacacccagccatcaag
gtgcacaattacagcggtcccctgcgtgttcgcatttcactggtgaccaagaacgcaccc
cacaagcctcacccacacgaactggttgggaaggactgcaaacatggatactacgaggcc
gacctgcaggagagaagaatacacagctttccaaatctgggcattcagtgtgtgaagaag
aaggatgtaaccgaagccatcacctgcaggctgcagaccaacaacaaccccttcaacatt
ccagagccgaaggtgtgggaagaggagtttgacctgaattctgtgcggctctgcttccag
gcctccttcactcagccgacaggcgagcgaatccagctgacgcctgtggtgtcccagccc
atttatgacaacagagccccaaacacagctgagctgaagatctgcagagtcaatcgcaac
tccggaagctgtaaaggaggagatgagatctttctgctgtgtgacaaagttcagaaagag
gacattgaagtccgcttcttccaggactcgtgggaggggaagggcaccttctcccaggcg
gacgtgcacagacaggtggccatcgtgttccgcacgccgccgtaccgcgacgccaacatc
tctgagcccatcagggtgaagatgcagctccggcggccgtcggaccgcgaggtcagcgag
ccggtggacttccagtacctgccggcggacccagacgagtacagactgagtgagaagagg
aagaggacgggagacgtgttccacggcctgaagctggggccgctcttatcaaccgtgacc
attccgcacgaccgacggcacataagtccgaggaggacggtgacggccaagcctcccgcc
acggtccccgcgcagactgcgcctcctattgccggagcagcaaagccgcagccttcgtac
tccttcagccagcagatgcagggcttctcggtgcatcctaagcccgactcctccccctcc
gcgacggccacacaccaagcgtggagaatcatggagagccttaacctgggcccccaacct
aaagctgctgcagtgtccagcttcccagtgacccaggctcccagctcctcggctgcctct
tcctcctccgtcaccacccccgccatcaaccaggaattctccaccgtcaaccagtccgac
cttgacgagttcttccccaacatatcggccggtgtctcccaggagccatcatcttctcaa
gggggcgtggcgtcctcacaactgggcggctccttcagcctgcagcccttccgcgtggac
cccactctcatggacgacaacatgtcggattttcccagcttcgaacaccagggtcagaac
actctggccagtctaaacatcgatgacttcgtggacttcctgaaccccgggctgatgacg
gaatgtggaaacggcgcctcgatggcgtgccatccgcccgctcctcccagctcctcctcc
gcggcccaaaacagcactgcagccgacgccgccaacatgcccggaagcacttggatgacc
tacccacaccccatcgccaacctgctccaaaacgaggccatgatggacgttgcgaccaat
gccaaccaccagcccgcggtgctggacgattacgacgtgctgacgtctgccgacgaggac
cgcctcatttccattttgacagtggaacccaggcccgctttgtgtcgggacatcccacct
aaagatctcctccagctgctgctcgcggccctaaagacgggacaagcgtcgcctgtgaag
atgatctgcaagagactgaatgtagcgccccagaaacgtccccacagcagcccagacgcc
agcgttccctttgtcccctacgaacgggaaccgccgggcgcttcagccgcaggtcagcgc
tga

DBGET integrated database retrieval system