KEGG   Takifugu rubripes (torafugu): 101074630Help
Entry
101074630         CDS       T02386                                 

Gene name
gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
tru04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101074630 (gaa)
   00500 Starch and sucrose metabolism
    101074630 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101074630 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101074630 (gaa)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101074630 (gaa)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101074630 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101074630
NCBI-ProteinID: XP_003964619
LinkDB All DBs
Position
5
AA seq 757 aa AA seqDB search
MKDPSSPRYEVELPAVVVREETDAEDLLYTTEYQPDPFGFIVRRKTNGRVIMNTTVAPLL
FADQYLQLSTTLASHLVSGLGQHYSSLLLDVNWTTLALWNRDMAPHADANLYGSHPFYIV
QEGDGMAHGVFLLNSNAIEVILQPTPALTWIALGGILDLYVFLGPDPQSVVRQYLQVIGY
SMMPPYWSLGFHLCRWGYTTTNATREVVQRMRDAEFPMDVQWNDLDYAYKRRVFTLDPLR
FGDLPEMVEEFHMRGLRYILILDPGISTTSPPGTYAPFQDGLKRDVFIKNSSGHILIGKV
WPGPTAFPDFTNPETRSWWEDCIRDFHSKVPVDGLWIDMNEPASFVQGSVEGCPDSELEN
PPYTPSVVGGRLSSGTLCMSAQQKLSTHYNLHNMYGLTEAFATHSALIKIHGKRPFVLSR
SSFPGIGRFSGVWTGDVRSDWEQLRYSIPAVLQFSLSGVPLAGADVCGFGGDTAEELCVR
WMQLGAFYPFMRNHNDRPNAPQEPYVFGQKAQAAMKSALNLRYSLLPFLYTLFHHAHTSA
ETVARPLFMEFPSDPGSQTVDEQFLWGSSLLISPVLKRGAVEVAAYLPPGTWYSLLNGRP
LHSRGQYFLLSAPLDTINVHLREGHIIPQQGPALTTTASRTNPFSLTVALSAGGWAWGDL
FWDDGDGLDTFETGNYSYIVFVAGESQVVSGPLTVGEALAGLVLGGLQVFGLQSAPIFVL
ANGEMVMDFTYCSEMKVLKVTNLALPLSEVLTIRWIL
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatccatcgtctccacggtatgaagttgagctcccagccgttgttgtcagggaa
gaaacagacgccgaagaccttctctacactacagaatatcagcctgacccatttggcttc
atagtgcggcgaaaaacgaatggaagagtcattatgaacaccaccgtcgctcctctgctg
tttgccgaccaataccttcagctctccaccacgctcgcctcccatcttgtgtcaggtctt
gggcagcactattcctccctcttgctggacgtcaactggacaactctggctctctggaac
agagacatggcgccacatgctgatgccaatctttatggctcccatccattctacatcgta
caggaaggggacgggatggcacatggagttttccttctcaacagcaacgcaattgaggtg
atattgcagccgacccctgctctcacctggatagctcttggaggaatcctggatctttac
gtcttcttgggccctgaccctcaaagtgtggtgcgacagtaccttcaggtgatcggatac
tctatgatgcctccttattggtcactgggctttcacctgtgtcgctggggttacaccacc
actaatgcaacacgggaagttgtgcaacgcatgcgcgatgctgaatttcctatggatgta
cagtggaatgatctagattatgcgtacaagcgtagggtcttcaccttggacccgttgcga
ttcggagacctcccagaaatggtggaggagttccacatgagaggcttgaggtacatcctc
atcctggatccaggcatcagcaccaccagccctcctggaacctacgctccatttcaggat
ggattaaaacgagatgtcttcattaaaaattcctcgggacatatcttgattgggaaggtt
tggcctggtcctacagcctttcctgacttcaccaaccctgaaaccaggtcctggtgggaa
gactgcatcagagattttcattccaaagttccggtggacggtctgtggatcgatatgaat
gaaccggcaagttttgtgcagggctctgtggaaggctgtccagacagcgagctggagaat
ccgccctacacccccagtgtggttggcggccggttgagctctgggactctgtgtatgtcc
gcccagcagaagctgtccacccactacaacctgcacaacatgtacggactgactgaggcc
tttgccacacacagtgctctcataaagattcacgggaagcggccattcgtcctgtctcgc
tcctcctttccaggcatcggacgcttctccggagtgtggacgggagacgtccggagtgac
tgggagcagcttcgctactccatccccgccgtgctgcagttcagcctgtccggggtgccg
ctcgccggcgccgacgtctgcggcttcggaggcgacaccgccgaggagctgtgcgtacga
tggatgcagctgggcgccttctaccctttcatgaggaatcacaacgacaggccgaatgct
cctcaggagccctacgtatttggacaaaaggcccaggccgccatgaaaagtgcattaaac
ctgcgttactccctcctgcccttcctctacacgctcttccatcatgcccacacctctgcg
gaaactgtggcccgacctctcttcatggagttcccctctgacccaggcagtcagaccgta
gatgagcagttcctgtgggggagttcacttttgattagccctgtcttaaagaggggggct
gtagaagtggctgcttacctaccccccggcacttggtacagtctgctgaatggtcggcct
ctccacagcaggggtcagtactttctcctgtcggcccctttggacaccatcaacgttcat
ttgagggaggggcacattattcctcagcaggggcctgctctgacgacaacagcctcgcgc
acaaaccctttctccctgacggtggcgctgtcagcaggcggctgggcgtggggcgatctg
ttctgggatgatggggatggcctcgacacctttgaaacgggaaattattcctatattgtc
tttgttgccggtgagtctcaggtggtgagcggacctctgacagtgggtgaggccctcgct
ggtctggtcctgggagggctgcaggtgttcgggctgcaatccgcacccatttttgtctta
gccaatggagaaatggtgatggatttcacatactgcagtgagatgaaggttttgaaagtg
accaacctggctttgccactgtcagaggtgttgacaatccgatggattctctga

DBGET integrated database retrieval system