KEGG   Takifugu rubripes (torafugu): 101075239Help
Entry
101075239         CDS       T02386                                 

Gene name
wbscr17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00512  Mucin type O-glycan biosynthesis
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101075239 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tru01003]
    101075239 (wbscr17)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101075239 (wbscr17)
Glycosyltransferases [BR:tru01003]
 O-Glycan biosynthesis
  Mucin-type
   101075239 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 101075239
NCBI-ProteinID: XP_003968738
LinkDB All DBs
Position
11
AA seq 598 aa AA seqDB search
MAFVFRRWRVLVVLNVLAVAGFMTFWAKCNTRTFQGGAEAAADGRRPRSNGTAQGPSMSH
DVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLSPAEESDAKYLREKYGY
NAYLSDRISLDRTIPDHRPGKCRKVGYPRDLPQISLIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVNDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKVASAE
VTGFFDAHVEFTPSWAEPVLARIKEDYKRIILPSIDNIKHDTFEVERYENSGHGYNWELW
CMYINPPKQWWDEGDASAPIRTPAMIGCSFVANRDYFGELGLLDSGMDVYGGENIELGIR
VWLCGGSMEVLPCSRVAHIARVKKPYHSNIAYHTRRNALRVAEVWMDEYRSNVYLAWNIP
MENHGIDYGDISQRVALRKSLQCKSFEWYLENVYPEMRRYNNTLFYGEIRNSKVSHLCMD
QGIKENHTATLHPCHGWGPQLGRYTKEGQLFLGPLGSTGEDTRCVVDDQLSSFPQLINCD
RVTNAKQMTWHFSQNESIVNQATGRCLEVVPANVYFGHLLILQPCTGQRWIIKNTMKQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgttcagaagatggagagttttagtggtgctgaacgtgctcgccgtcgct
ggattcatgactttctgggccaagtgcaacacacgcaccttccaaggcggcgcggaggct
gcggctgacggcaggaggccccgaagcaacggaacggcgcagggacccagcatgagccat
gatgtgctgctgaagaggctcagctccctggaggatgtagtgtacaggcagctgaatggt
ctgtccaaatcgctgggtctgatcgagggcttcgggggtcgaggtaaaggcggtcttcct
gccactctgtcaccggctgaggagagcgacgctaaatacctgagagagaagtatggctac
aacgcgtacctcagtgacagaatctctctggaccggaccataccagaccaccggcccggc
aagtgcaggaaggtcggctatccgcgagacctgccgcagatctccctcatcttcatcttc
gtcaacgaggctctgtccgtgatactgcgctcagtccactcagctgtcaatcacactccg
gcacacctgctcaaagaaatcatcctggtgaacgacaacagcgacgacgagcagctgaag
gggccactggaggagtatgtgaacaagcgctaccccggcctggtgaagatcgtcaggaac
cagaagagggagggactgatccgagccagaatcgagggctggaaggtcgcgtccgctgag
gtgacgggattcttcgacgcccacgtcgagttcacgccgtcctgggccgagccagtcctg
gccagaataaaagaggactacaagaggattattcttccctccattgacaacatcaagcac
gacacgtttgaggtggagcgctacgagaactccggccacggctacaactgggagctgtgg
tgcatgtacatcaacccgcccaagcagtggtgggacgagggagacgcgtctgctcccatc
aggactcctgccatgattggctgctccttcgtggccaaccgggattactttggcgaactg
ggcctgctggactcgggcatggacgtgtacggaggggagaacatcgagcttggcattagg
gtgtggctctgtggaggcagcatggaggtgctgccatgttccagggtggctcacatcgca
cgggtcaagaagccctaccacagcaacatcgcttaccacacgcgccgtaacgctctccgc
gtggctgaggtctggatggatgaatacaggtccaacgtctacctggcctggaacatcccc
atggagaaccacggcattgattacggcgacatctcccagagggtcgcgctgaggaagagt
ctgcagtgtaaaagctttgagtggtacctggagaacgtttatccagagatgaggaggtac
aacaacaccttgttctacggcgagatccgtaactctaaagtgagccacctgtgtatggat
caggggataaaagagaaccacacggccaccctgcacccctgccacggatggggaccccag
ctgggacgttacaccaaagagggacagctcttcttgggtcctctgggaagcacgggggag
gacactcgctgcgtggtcgacgaccagctcagcagcttccctcagctcatcaactgtgac
agggtgaccaacgccaagcagatgacgtggcatttctctcaaaacgaatccatcgtaaat
caggccacgggaagatgtctggaggtggtgcccgctaacgtttactttggccacctgctg
atcctgcagccctgcactggccaacggtggatcatcaagaacacgatgaagcagtaa

DBGET integrated database retrieval system