KEGG   Takifugu rubripes (torafugu): 101075988Help
Entry
101075988         CDS       T02386                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101075988
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101075988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 101075988
NCBI-ProteinID: XP_011612863
LinkDB All DBs
Position
20
AA seq 783 aa AA seqDB search
MHGEALRDGSTLGRFPSITLGVVDGTEVEATEPEESESACRQWLRKICPCCHPKPDDDSK
DALVTAIDDDDDEGEPTPEKPEKPEKPEKPETGGSELEDLLLRVRSVDLMKSAQGVNRTK
HHTDLYHTDAFIIRRGQNFQMGISLSRPFDPKNDKLHLILKTGPLPTVAKGTQVDVPLVE
SLVGGRWEAAAVKQEGNRIQLSVNSPATTAIGRYQLTVETTCVGGHAVSTHDPANDVYIL
FNPWCEEDTVFMDSEEERREYVLNDVGRIYYGTQDQIGQRTWNYGQFDDGILAICLFILE
KSGTPPSGWGDPVNVVRVISAMINAVDDNGVLVGNWSGNYSAGTSPTVWSGSIEILREYH
KNNAAPVKYGQCWAFAGVFTTVLRCLGIPARTVTNYSSAHDTDVSLTTDVYLDENLDPIN
HLNTDSVWNFHVWNDCWMARPDLPLGNGGWQAVDATPQETSQGTFRCGPTALTAVRNGYV
YLKHDTPFVFAEVNSDKIYWQKNADGTFNQIYSEKKTVGHSISTKAVGSDERSDITHLYK
HAEGTEQERIAVETACRYGSKAAAYSSXCCRDVSLKVSMDGKGPKMGQDVDLSITMVNSS
AEHRTIVLHSQVSVMYYTGVHKAIIGQDRTDVTLSPVKVLEWTLEYKDYKDQLVDQAALM
LTLSGRVNETQRILATQFSFRLRTPDLSIKPLGKAVVGERMAVEISFTNPLPQVLKAVIF
HLEGLGLVTARKINYGDIGSLASMSVTEHFVPSLPGARKLMASLDCKQLTQVHGVADITV
AAS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgcacggggaggcgctcagagatggatccacattgggacgcttcccgtccatcactctg
ggagttgtggacggcacggaggtggaagcgacagagcccgaggagagcgagtcggcgtgt
cgacagtggctgcgcaaaatctgcccctgttgccaccccaaacccgatgatgacagcaaa
gatgccttggttacggcaattgatgacgatgatgacgagggagaaccgacgccggagaag
ccggagaagccagagaagccggagaagccggagactggcgggagcgagctggaggatctc
ctcctccgagtgcgatccgtagatctgatgaagagcgcgcagggcgtgaaccggaccaag
caccacaccgacctctaccacactgatgcttttattattcgtagagggcagaacttccag
atgggcataagcctgtcgcgaccctttgaccccaaaaacgacaaactccatctcatacta
aaaacagggccgctgccaaccgtggcaaaggggacccaggtcgacgtccctttggtggag
agcctggtgggcgggcgatgggaggctgccgcggtgaagcaggaaggcaaccggattcag
ctgtcggtgaactctccggccacgaccgccatcggccgatatcagctcacggtggaaacc
acctgcgtgggcggccatgctgtttccacacacgatcctgcgaatgacgtgtacatattg
ttcaatccctggtgcgaagaagacacagtgttcatggattcagaagaggagaggcgggag
tacgtcctgaatgatgttggaagaatctactatggcacccaagatcaaattggacagcgg
acgtggaactatgggcagttcgacgatgggatccttgccatatgcctcttcatcctggag
aagagcggaacccctccatctggctggggagatccggttaatgtggtgcgggtcatctct
gccatgatcaacgccgtggatgacaacggtgtcctggtgggaaactggtctggaaactac
tcggctgggaccagtccgaccgtgtggagcggaagcattgaaatcctgcgggagtaccat
aaaaacaatgccgccccggttaagtacggacagtgctgggcctttgctggtgtcttcacc
acagttttaagatgtttggggattcccgctcgcaccgtgaccaactatagctcagctcat
gacacagacgtctccttaacaacagacgtgtacctggatgagaatctggatcctataaat
cacctcaacacggactcggtctggaacttccatgtgtggaacgactgctggatggctcgt
ccagacctgcctctgggcaacggaggctggcaggctgttgatgccacaccgcaggagacc
agccaaggcacttttcgctgcggtcccaccgccctgactgctgttcgcaatggttacgtc
tacctcaaacacgacactccgtttgtgttcgcagaggtcaatagtgataaaatttactgg
cagaagaacgcagacggaaccttcaatcagatctacagcgagaaaaagacagtgggccac
tccatcagcacaaaggctgtcggatctgacgagcgcagcgacatcacgcatctgtacaaa
cacgctgaaggtacggagcaggagcgcattgccgtggaaacagcatgcagatacggctca
aaggctgcggcttattcctctnnctgctgcagagacgtctctctgaaggtttccatggac
ggcaaaggtcctaaaatgggacaggacgtggacttgtccatcaccatggtgaacagcagc
gcagaacaccgcaccatcgtcctgcacagccaggtgtcagtcatgtactacactggagtg
cacaaggccatcatagggcaggacaggacagatgtgacgctctccccagttaaggttttg
gagtggacgctggagtacaaagactacaaggaccagctggtggaccaggccgctctgatg
ctgaccctgtcaggccgagtcaatgagacccagcggatcctagccacccagttcagcttc
aggctcaggaccccggacctcagtataaaaccgcttggaaaagccgtggtgggcgagagg
atggcggtggagatctcatttactaacccgctgccacaggtgctgaaagcagtgatattc
cacctggaaggactcggccttgtaaccgctcggaagatcaattatggtgatatcggcagt
cttgcctccatgtctgtgactgaacacttcgtcccctcgttgcctggagcaaggaaatta
atggcttccctggactgtaaacagctcacgcaggtgcatggcgtggccgacatcactgtt
gctgcatcataa

DBGET integrated database retrieval system