KEGG   Takifugu rubripes (torafugu): 101076168Help
Entry
101076168         CDS       T02386                                 

Definition
(RefSeq) transketolase-like
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00030  Pentose phosphate pathway
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru01230  Biosynthesis of amino acids
Module
tru_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tru_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101076168
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    101076168
Enzymes [BR:tru01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     101076168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr Transketolase_C Transketolase_N Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 101076168
NCBI-ProteinID: XP_003979034
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
YRVFCLLGDGELSEGSVWEAMAFASYYQLDNLVAILDIXXXXXXXXXPLQHHVEKYQRRC
EAFGWHAIIVDGHSVEELCKVLSQPRHQPLAIIARTIKGKGIPVAEDKMGWHGKPLARDM
ADSVIKELQSRIMSCNKRVYPSPPKEDTSAVSLRNFRMPSAPSYKPGEKVATRKAYGMAL
AKLGRYNERMVVLDGDTKNSTFSELFKNEHPNRYVECYIAEQNMVSVAVGCAVRDRNVVF
ASTFAAFFTRAYDQLRMAAISESNINLCGSHCGVSIGEDGPSQMGLEDLALFRAIPTATV
FYPSDGVSTEKAVELAANTKGLCFIRTSRPESNIIYNCNEDFHVGQAKVVYKTNDDHVTV
VGAGVTLHEALAAAEQLKKERINIRVIDPFTIKPLDHKTIIDNARVTRGRIITVEDHYYE
GGLGEAVCSAVVNETGFTVHRLAVTQVPRSGKPHELLRVFGIDRDAIVQAVHKVLSGSSN
AK
NT seq 1450 nt NT seq  +upstreamnt  +downstreamnt
ttatcgggtcttctgcctgctgggggacggagagctgtctgaaggctcggtgtgggaggc
catggccttcgcctcctactaccagctcgacaacctggtggccatcttggacatcnnnnn
nnnnnnnnnnnnnnnnnnnnntccgctccagcaccacgtggagaaataccagcgacgctg
tgaggcctttggctggcacgccatcattgtagacggccacagcgtggaggagctgtgcaa
ggtgctgagtcagcctcgccatcagcccctcgccatcatcgccaggaccatcaagggcaa
gggcatcccagtggccgaggataagatgggctggcacgggaaacccctggccagggacat
ggctgacagcgtcatcaaggagctgcaaagccgcatcatgagctgcaacaagcgcgtcta
cccgtcgccccccaaggaggacacgtcggccgtcagcctccgcaacttccgtatgccgag
tgcgcccagctacaaacccggagagaaggtggctacgaggaaggcgtacggcatggcgct
ggccaagctcgggcgttacaacgagcgcatggtggttttggacggggacaccaagaactc
cacgttctctgagctcttcaagaacgaacacccaaaccgctacgtggagtgctacatcgc
ggagcagaacatggtgagcgtggccgtcggttgtgccgtgcgggaccgcaacgtggtctt
cgctagcacttttgctgcgttcttcacccgggcctacgaccagctccgcatggcggccat
ttccgagagcaacatcaacctctgcggctcccactgcggcgtttctatcggcgaagacgg
accgtctcagatgggtctggaagacctagccttgtttagggccatacccactgcaactgt
cttctaccccagcgatggtgtctccactgagaaagctgtggagcttgctgccaacaccaa
gggtttatgtttcattcggacaagccgaccggagagcaacatcatctacaactgcaatga
agacttccatgttggccaagctaaggttgtgtacaagaccaacgacgaccacgtgactgt
ggttggagccggagtgaccctccacgaggctctcgcagctgccgagcagctgaagaaaga
aagaataaacatccgtgtgatcgatccattcaccatcaaacccctggatcataaaaccat
catcgataacgccagggtcaccagaggtcgcatcatcacagtggaggaccattactacga
aggtggtctgggagaggccgtgtgctcagccgtggtgaacgagaccggcttcaccgtgca
ccgcctggcggtcacccaggtccctcgcagcggcaagccgcacgagctgctccgggtctt
tggcatcgaccgcgacgccatcgttcaggcggtgcacaaagtgctcagcggctcctccaa
cgccaagtga

DBGET integrated database retrieval system