KEGG   Takifugu rubripes (torafugu): 101076176Help
Entry
101076176         CDS       T02386                                 

Gene name
hdac1, HD
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04110  Cell cycle
tru04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101076176 (hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101076176 (hdac1)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101076176 (hdac1)
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101076176 (hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     101076176 (hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101076176 (hdac1)
  Chromatin remodeling factors
   NuRD complex
    101076176 (hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101076176
NCBI-ProteinID: XP_011617479
LinkDB All DBs
Position
2
AA seq 490 aa AA seqDB search
MALTSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
NGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSVGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLG
GGGYTIRNVARCWTYETAVALDASIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEAEDHNKRISIRAHDKRIACEEE
FSDSEDEGEGGRRNSVSFKKAKRAKTEGEKEGEEKEKKGEEETKEVKEEEKVPEEEKMDT
SKPKEESKTP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttacttcccaaggaacaaagaaaaaagtttgctactattatgatggtgacgtt
gggaattattactatggccagggtcatccgatgaaaccccacagaatccgcatgacccac
aacctcctgctcaattatggcctctacagaaagatggagatttaccgtccgcacaaagct
aacggagaggagatgaccaagtaccacagcgacgattacatcaaattcctgcgctcgatc
cgaccggacaacatgtcggagtacagcaagcagatgcagagatttaacgtgggagaggac
tgtccggtgtttgacggtttgtttgagttctgccagctgtccgtggggggctccgtcgct
ggtgctgtgaagttgaataagcagcagacagacatcgccatcaactgggccggagggctt
caccacgccaagaaatccgaggcctcgggattctgctatgtcaacgacatagtgctggct
attctggaattactgaaatatcaccagcgagttctctacattgacatcgacatccaccac
ggcgacggcgtggaggaggccttttacaccacggaccgcgtgatgaccgtctcattccac
aagtatggagagtacttccctggcacgggcgacctgagggacatcggcgctgggaagggc
aaatactacgctgtgaattaccctctgagggacgggatcgacgacgagtcctacgaggcc
atctttaaacccatcatggccaaggtcatggagatgtaccagcccagcgcggtggttctc
cagtgtggagccgactcgctgtcaggagacaggctgggatgctttaacctcaccattaaa
ggtcacgccaagtgcgtggagtacatgaagagcttcaacctgccgctgctgatgctcggc
ggaggaggctacaccatccgcaacgtggcgcgctgctggacctacgagaccgccgtggct
ctcgatgcctccatccccaacgaacttccatacaacgactactttgagtactttggaccc
gacttcaagctgcacatcagcccgtctaacatgaccaatcagaacaccaacgactacctg
gagaaaatcaagcagcgcctgttcgagaatctgcgcatgcttcctcacgcccccggcgtc
cagatgcaggccatccccgaagacgccgtgcaggaggacagcggagacgaggaggcggag
gaccacaacaaacgcatctccatccgcgctcacgacaagaggatagcgtgcgaggaagag
ttctccgactccgaggacgagggagaaggaggccggagaaactcggtcagcttcaaaaaa
gccaagagggccaaaacagaaggagagaaggagggagaagaaaaggagaagaaaggtgag
gaggaaacaaaagaagtgaaagaagaagagaaggtgccagaggaggagaagatggacacc
tccaagcccaaagaggagtccaagacaccgtga

DBGET integrated database retrieval system