KEGG   Takifugu rubripes (torafugu): 101076572Help
Entry
101076572         CDS       T02386                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00020  Citrate cycle (TCA cycle)
tru00190  Oxidative phosphorylation
tru01100  Metabolic pathways
tru01200  Carbon metabolism
Module
tru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tru_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101076572 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101076572 (sdha)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101076572 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 101076572
NCBI-ProteinID: XP_011603688
UniProt: H2V735
LinkDB All DBs
Position
7
AA seq 663 aa AA seqDB search
MASVTAASRLLSKRLLTKTLPVPAATVQGSRNFHFSVYGKKSNAKVSDNISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDDWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPQAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTTYFVEYFALDLLMENGECKGVIALCMED
GSIHRFRAQNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEK
DHVYLQLHHLPPQQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQV
ITHTNGADKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEEHKPGEKL
SPLKPNAGEESVANLDKLRFSNGSLRTSEIRLNMQKAMQSHAAVFRTGSVLKEGCDKMDA
IYQTMDDIKTFDRGIVWNTDLVETLELQNLMLNGIQTIYSAEQRKESRGAHAREDFKDRI
DEYDYSKPIQGQEKKPFEQHWRKHTMSYVDPKTGKVTLEYRPVIDSSLNEQECAHVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgtgactgctgcgtctcgtctcctctctaagagattactaactaaaacactg
ccagttcctgcagccacagttcaaggttcaaggaactttcatttctcagtctatgggaag
aagagtaatgccaaagtatctgataatatctctacgcagtacccagtagtagatcatgag
tttgacgctgtcgtggttggagctggaggagcaggactcagggcagcctttggtctgtcg
gaggctggcttcaacactgcttgtgtcaccaagctcttccccaccaggtctcacactgta
gctgcacagggtgggatcaatgctgctctggggaacatggaggacgatgactggaggtgg
catttctatgacacggtgaagggatctgattggctgggagaccaggatgctatccattac
atgacagagcaggctccgcaagctgtagtggagttggagaacttcggcatgcctttcagt
cgcactgaagatggaaagatctaccagcgagcttttggcggtcagagcctgaagtatgga
aaagggggccaggctcaccgatgctgctgtgtagctgacaggacaggccactcgctgctg
catacactttacggaaggtcacttcgttatgacaccacttactttgttgagtacttcgcc
ctggaccttctgatggagaacggagagtgtaaaggagtgattgctctctgcatggaggat
ggatctattcaccgcttcagagctcagaatacagtcattgctactggaggttatggaaga
acctatttcagctgcacatctgcccacactagcactggagatggaaatgccatggtgacc
agagctggcctgccctgtcaggatctggagtttgtccagttccaccccacaggcatctac
ggagccggttgtctgatcactgagggttgccgtggtgaaggaggtatcctgatcaacagc
gaaggagaacgtttcatggagcgttatgcacccaatgctaaggacctggcctctagagat
gtggtgtctcgctccatgacaatagagatcagagagggcaggggtgttggtccagaaaag
gaccacgtgtacctccagctccaccacctccctccccagcagctggcctccaggcttcct
ggcatttcagaaactgccatgatctttgctggggttgacgttaccaaagagcccatccct
gtcctgcctactgttcactataatatgggtggaatacccacaaactacaaaggacaggtc
atcactcatactaatggagccgataaggtggttcctggactgtatgcctgtggtgaggcg
gcctgtgccagcgtccacggcgctaaccgactgggtgccaactcccttctggacttggta
gtgtttggtagagcctgcgctctcaccatcgcagaggagcacaaacctggggagaaattg
tccccactgaagcccaacgcaggagaagagtctgtggccaatctggacaagctgaggttt
tccaacggaagcctgagaacttcagagattaggctcaacatgcagaaggccatgcagtct
catgctgctgtgttccgtactggctcagttctgaaggagggatgtgacaagatggatgct
atttaccagactatggatgacatcaagacctttgacagaggtattgtgtggaacacagac
ctggtggaaactctggagctgcagaatttgatgttgaacggcatccagacgatctactct
gctgagcagaggaaggagagcagaggagcccatgcaagagaggactttaaggaccgtata
gatgagtacgattactcaaagcctattcagggtcaggagaagaagccctttgagcagcac
tggaggaaacacactatgtcctatgtggaccccaagactggaaaggtgaccctggagtac
cgccctgttatcgacagctctctgaatgaacaggagtgcgcccacgtcccacccgccatc
cgctcctattaa

DBGET integrated database retrieval system