KEGG   Takifugu rubripes (torafugu): 101076752Help
Entry
101076752         CDS       T02386                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
tru04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101076752
   00500 Starch and sucrose metabolism
    101076752
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101076752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101076752
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101076752
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101076752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101076752
NCBI-ProteinID: XP_011611150
LinkDB All DBs
Position
17
AA seq 974 aa AA seqDB search
MKMASYKRLSPEDVYLSCPGSAKQPSVVPEQFPEPEEEESHLLPRQPLWSFNRGLLVIGC
LLLVLCLGWLLSTMFWLHRPFGQHSHRPPPPVAAKRPNSNTTTGLNGTAAPSLRDTCGLI
PESWRFDCYPERGVVVTRELCEARNCCFIPATSSPTPPPSGRNGIPWCFYPQDFPSYKLV
SINDTSLGQKGTLVKEVKTYYPADILTLEVDIHHETDTRLHVKIVDPSNPRYEVPISVPC
ATKKAENPDYLVEISKQPFGLVVRRKSTGAVLLNTTVAPLFYADQFLQMSTSLPSPFIYG
LAEHRSSFLQDVHWNTLTMWARDVPPMEQTNLYGTHPFYLVMEDEGAAHGFFLLNSNAMD
VSLQPAPALTWRTIGGIFDFYMFLGPDPASVIGQYVEVVGYPTMPIYWALGYHLCRWGYG
DNNSTWEIVKRMRNYGIPQDVQWNDIEYMDRYLDFTLDSKFSALPDMIKDLHAHDQRYVI
IVDPGISSTQPEGSYWTYEDGLKRDVFVKDSEGNVIIGKVWPGLTAFPDFSNEETHEWWY
DNLKRYHEKVPFDGLWIDMNEPSNFLEGSTKGCPSTSLENPPYTPGVLGGSLKAKTLCAS
AQQKLSSHYNLHSLYGLMEAKATASALKRIIPKRPFVISRSTFPSQGMYSGHWLGDNKSS
WKDLYFSIAGMLNFNLLGIPLVGADICGFMEDTQEELCVRWTQLGAFYPFTRNHNDIKSK
AQDPTVFSPLARTAIKDAILLRYSLFPYLYTLFHHAHVKGQTVARPLMFEFPKDVRTYGI
DKQFLWGRSLLVTPVLDPGVDYVVGYIPEGLWYDYYTGDPVHSKGEEVKLHAPLDKINLH
LREGSVTPTQTPNLTLWVSSGQPLHLVSALSEDGSACGDLFWDDGESLDTYESNQYSYII
FNVTQNVMTSEVLHSNVEATYITVETASFYGVKQKPSRVLVNSQDAVFSYRENQVLTVAD
LGLNLSQNFTIRWV
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggcttcctacaagcgtctgagtcctgaagatgtctacctgtcctgtccaggt
tcggccaagcagccttctgtggtgccagaacaatttccagaaccggaggaggaggaatcc
cacctgctgccccgtcagccgttgtggtctttcaacagaggcctcctggtgatcggctgc
ctgctgctggtcctttgtcttggctggttgctcagcaccatgttctggcttcacagacct
tttggccaacattcgcacagacctccaccaccagttgctgccaaaagaccaaattctaac
accacaacgggcctgaacggtaccgccgctccttccctccgcgacacatgcggtttaatc
ccagagagctggaggttcgattgctaccccgaaagaggagtggtcgtgacccgggagttg
tgcgaggccagaaactgttgctttatccctgcgacctcctcccccaccccacctccctcg
gggagaaatggcatcccttggtgcttctatcctcaagattttccttcctacaaacttgtg
tccattaatgacacgtctcttggacagaagggcaccctcgtgaaagaggtgaagacctac
taccctgcagacatcctcaccctggaggtggacatccatcacgagacggacacgcggctt
catgtcaagatcgtcgacccgtcaaatccgcgctatgaggttccaatctccgttccctgc
gccaccaaaaaagcagaaaatccagactacttggttgagatttcaaagcagccgtttggt
ctggtggtcaggaggaagtccactggggccgttctcctgaacaccacagtggctcctctc
ttctacgcggatcagttccttcagatgtccacctccctgcccagccccttcatctacggc
ctggctgagcatcgctcttcattcctccaagatgtccattggaacaccctcaccatgtgg
gccagagatgtaccccctatggaacagaccaacctttatggaacccatcctttttatctg
gttatggaggacgagggggccgcgcacggcttcttcctgctcaacagcaacgccatggac
gtgagcctccagcctgctccagccctcacctggcgcactattggaggcatctttgacttc
tacatgttccttggtcctgatccggcttcagtgattggacagtatgtggaagtcgtaggc
tacccgacgatgcccatctattgggctttgggctaccacctctgtcggtggggctacggg
gataacaattcaacctgggagattgtcaaacgcatgaggaattatgggatacctcaggac
gtccagtggaacgacattgaatacatggatcggtacctggatttcactttagattccaag
ttctccgcactgcctgatatgatcaaggacctgcacgctcacgaccagcgatatgtcatc
atcgtggatccgggcatcagcagcacgcagcccgagggctcgtactggacgtatgaggac
ggactgaagagagatgtgtttgtcaaagactctgagggaaacgtcattatcgggaaggtg
tggcccggactgacggcatttccggatttctccaatgaggaaacgcacgaatggtggtac
gacaacctgaagaggtaccacgagaaggtgccgtttgatggcttatggattgacatgaac
gaaccatcaaatttcctggagggcagcaccaaaggctgcccatcaaccagtctggaaaat
cctccttacacgcctggtgtcctcgggggctctctgaaagccaaaactctgtgtgccagc
gcgcagcagaagctgtcctcgcactataacctgcacagcctctacggcctgatggaagcc
aaagccaccgccagtgctctgaaacggatcattccaaagagacccttcgtcatctcccgc
tccaccttccccagtcaggggatgtactctggtcactggctgggagacaacaagagcagc
tggaaagacctgtacttttccatagcaggtatgctaaattttaatctcctgggcatcccg
ttggtgggagcagatatctgtggcttcatggaggatacgcaggaggagctgtgtgtccgc
tggacacagttgggagcgttctatcccttcacccgcaaccacaatgacatcaaaagtaag
gcccaagacccaacagtttttagcccgctggcccgcaccgccataaaggacgccatcctg
ttgcgttattctctctttccttacctttacacgctcttccatcacgcccatgtgaaggga
cagactgttgcgcggcccttgatgttcgagttcccaaaagatgtcagaacttatgggatt
gacaaacagttcctgtgggggaggagtttactggtgaccccggtgctggatcctggggtg
gactatgtggtgggttacatcccagaagggctgtggtacgactactatacgggcgacccc
gttcatagtaaaggtgaagaggtcaaactccacgcccctctagataagatcaacctacac
ttgcgtgaaggctctgtaacaccaacgcagacgcccaacctgaccctgtgggtcagcagc
gggcagcccctccacctcgtctcggctctctccgaggacggttctgcctgtggagatctg
ttctgggacgacggggagagcctcgacacctacgagagcaaccagtactcctacatcatc
tttaatgtcactcagaatgtgatgacatcagaggtactacacagcaatgttgaagccact
tacatcaccgtggaaacggcctctttctacggagtgaagcagaaacccagcagagtcctg
gtgaactcccaggatgccgttttctcctacagagaaaaccaggtgttaacggtggctgat
ctcggtctcaacctcagtcagaacttcaccatccgctgggtgtga

DBGET integrated database retrieval system