KEGG   Takifugu rubripes (torafugu): 101076984
Entry
101076984         CDS       T02386                                 

Definition
(RefSeq) uncharacterized protein LOC101076984
  KO
K08774  transforming growth factor, alpha
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101076984
   04012 ErbB signaling pathway
    101076984
SSDB
Motif
Pfam: EGF V_ATPase_I
Other DBs
NCBI-GeneID: 101076984
NCBI-ProteinID: XP_003973363
Ensembl: ENSTRUG00000024683
LinkDB
Position
19
AA seq 276 aa
MMTRMFWDTIFLISGSLFTLGAGPSNSTVVKPPQASSSTSGAAGDAGPPTTVATVDNVPP
VQSFLFATGAEPSSMGATEARIPTENTFTAALSTSTSNPAATAAGVPTPAGRFFPSPGAD
LGNMTAAGADNAADTVHAGDLNTSTTAATTTATPVKKFVAAAVRAHFDECPDSHRHFCFH
GSCRFLILEETPACVCHPGFIGMRCEHADLLAVVATNHKQTVTTVLVLCVIGCVLVMLLC
MLLHCWWRQECRRRRQAHHYCPKKHGVSFHPSESVV
NT seq 831 nt   +upstreamnt  +downstreamnt
atgatgactcggatgttctgggacacaatttttctcatcagcggttccttgttcacgtta
ggagcggggccgagcaactccacggtggtcaaaccgccccaggcctccagcagcacctct
ggggcagcgggagacgcgggtccacccacaactgtagccaccgtggataacgtccctccg
gttcaaagtttcctctttgcaacgggagcagagccgagcagcatgggagcaacggaggcc
agaattcccactgaaaacaccttcactgccgcgctcagtacctcaaccagcaaccctgcg
gcgacagcggcaggcgtccccacgccggctggacggttcttcccgtcaccaggagctgat
ctgggaaatatgacggcagcgggagccgacaacgccgctgacaccgtccacgccggggat
ttgaatacttcaacaaccgcagcaacaacaactgcaactccagtaaaaaagtttgtggct
gcggctgtccgggcccatttcgacgagtgtccagactctcaccgccatttctgcttccac
ggctcctgtcggttcctgatcctggaggagacgcctgcgtgtgtgtgccacccaggcttc
atcgggatgaggtgtgagcacgcagacctgctcgccgtggtcgcaacaaaccacaaacag
acggtcacaacggttctggtgttgtgcgtgatcgggtgtgttctggtcatgcttctgtgc
atgctgctgcattgctggtggagacaagagtgtcgcaggcggagacaggcgcatcactat
tgcccaaagaagcacggcgtatccttccacccttctgagagcgtggtctga

DBGET integrated database retrieval system