KEGG   Takifugu rubripes (torafugu): 101077419Help
Entry
101077419         CDS       T02386                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101077419 (mapk6)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101077419 (mapk6)
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101077419 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101077419
NCBI-ProteinID: XP_003969699
UniProt: A0A3B5KNU8
LinkDB All DBs
Position
13
AA seq 768 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLTEDVVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIRNDMSKPHTPLAKLLPDVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPVSLHPFHIEDEVDDILLMDQSHSHTWDRCHESQL
SEADWHLHSIHDPDEVQVDPRGLSDVTDEEEVQVDPRKYADGDWEKFLDEPSFDYSLHFL
PDRSWQDNDHHENKYCDLQCSHTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWK
EQQSKEKADRKAKSKCEKNGLVKAQIALKEAGKTQDPVEKDSEQEKHQTERPQSQQTQGF
DFDSFIASTIKLSLQPEPCPEVTLLNDVGFLNELNSSVSQLEAPRSGSMSKSVSQEKEEK
CLVNLAQLGGGGLGFGDSTWPVEPCPSFAFGLTVEESGCLIDEACWDIRKEDHLQKESTY
TSYLDHLFSRKEESVVETVASLEMESSEVREVDEGFLSRNAEIVLNVQLDSLALPLPLPL
PLPLPLPGFDSSDDLPLKSIQASLTPCAVKCSPQIAHKTYSSIFKHLN
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgagtccctgatgaacatccatggttttgacctgggttcccgctac
atggacttaaagccacttggttatggagggaatggcctggtcttctccgccgtcgacacg
gattgtgataagcgtgtggctgtgaagaaaataatcttgactgacccgcagagtgtgaag
catgccctgcgggaaatcaagatcatcagacgcctcgatcatgataacattgtcaaggtt
tttgagacattgggccctagtggtcgcaggctaacggaggatgtggtgtccctgacggag
gttaactcggtgtacattgtgcaagagtacatggagacagacctttgtcaattgttggag
aggggccttctttcagagggccatgccagactcttcatgtaccagctcctcaggggcctt
aagtatatccactctgctaacgtgctgcaccgagacctcaagcccgctaacttgtttgtc
aatacggaagacctggtacttaagattggggactttggcctggctcgcatcatggacccc
cactattctcacaagggccatctttcagagggcctagtcaccaagtggtatagatcgccc
cgtctgctgctctctcctaataactacaccaaagccatcgacatgtgggcagctggctgc
atctttgccgagatgctcacagggaaaaccctctttgctggtgcccacgagctggagcag
atgcagctgatcctggagtccatacctgtgctgcgggaagaagaccgccaagagctccac
agcgtcatcccggtcttcattcgtaacgatatgtccaagcctcacacaccactagccaag
ctgctgcctgatgtctctccccaggccttggatttcttggagaagatcttgacgtttaac
cccatggaccgcctgactgctgaagaggccctggcccacccctatatggctgactactcc
ttccctttagatgagccagtctctctgcaccccttccacatagaggatgaagtagatgat
atcctgcttatggaccagagccacagccacacctgggacagatgtcatgaaagtcagctc
tctgaggctgactggcacctacacagcatccacgacccagatgaagttcaggttgaccca
agaggactctctgatgtaacagatgaagaggaggttcaggtggatcctcgcaaatatgct
gatggagattgggagaagttcctggatgagccatcctttgactactcccttcatttcctt
ccagacagatcctggcaggacaatgaccaccatgagaataaatactgtgacttacagtgt
agccatacgtgtaactacaaggccgtgtcaccctcatacctagacaacctcatctggagg
gacagtgaagtcaaccactactacgaacccaagctcattattgacctctccaactggaag
gaacagcagagcaaggagaaagctgaccgcaaggccaagagtaagtgtgagaagaatggg
ttggtaaaggcacagattgcgttaaaggaagcaggaaagacccaggatcctgtggagaag
gacagcgagcaggaaaaacaccagacagaaaggcctcaaagccaacagacccagggcttt
gattttgactcctttatcgccagcaccatcaaactgagcctgcagccagaaccctgtccg
gaggtgacgctgctcaacgatgtgggcttcctgaatgagctcaactcctccgtctcccag
ctggaggctccccgctcgggctctatgtccaagtctgtgagtcaggagaaagaggagaag
tgcctggtgaacctcgcccagttgggcggaggagggctgggattcggggacagcacctgg
cccgtcgagccttgtccgagtttcgcctttgggctgacggttgaggagagcggctgtttg
atagatgaagcatgctgggacatacgcaaagaggaccacctgcagaaggagagcacttac
accagctacctggaccacctgttcagccggaaggaagagagcgttgtggagactgtggcc
agcttggagatggagtcatcggaagtgagagaggtggacgagggcttcctcagcaggaat
gcagagattgtgctgaacgtgcagctcgattccctggctctgcccctgcccctgcccctg
cccctgcccctgcccctgcccggctttgacagctccgacgatttgcctctaaagtccatc
caggcctccctgactccctgtgctgtcaaatgctcccctcaaattgcccacaaaacttac
agcagcatcttcaagcatcttaattaa

DBGET integrated database retrieval system