KEGG   Takifugu rubripes (torafugu): 101077479Help
Entry
101077479         CDS       T02386                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00053  Ascorbate and aldarate metabolism
tru00071  Fatty acid degradation
tru00280  Valine, leucine and isoleucine degradation
tru00310  Lysine degradation
tru00330  Arginine and proline metabolism
tru00340  Histidine metabolism
tru00380  Tryptophan metabolism
tru00410  beta-Alanine metabolism
tru00561  Glycerolipid metabolism
tru00620  Pyruvate metabolism
tru01100  Metabolic pathways
Module
tru_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101077479 (aldh2)
   00053 Ascorbate and aldarate metabolism
    101077479 (aldh2)
   00620 Pyruvate metabolism
    101077479 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101077479 (aldh2)
   00561 Glycerolipid metabolism
    101077479 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101077479 (aldh2)
   00310 Lysine degradation
    101077479 (aldh2)
   00330 Arginine and proline metabolism
    101077479 (aldh2)
   00340 Histidine metabolism
    101077479 (aldh2)
   00380 Tryptophan metabolism
    101077479 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101077479 (aldh2)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101077479 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101077479
NCBI-ProteinID: XP_003965899
UniProt: H2UGI1
LinkDB All DBs
Position
7
AA seq 518 aa AA seqDB search
MLRTVLLRALPRFGCPAVCRYSAAAIPVPNTQPEVHFNKLFINNEWHDAVNGKTFPTINP
STGEVICQVAEADEADVNKAVKAARDAFRLGSPWRRTDASHRGLLLNRLADAIERDSAYL
AELETLDNGKPYAVAYSVDLPNVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLVKEVGFPEGVVNILA
GMGPTAGAAIVRHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIILSDAN
MEDAVEQSHFALFFNQGQCCCAGSRTYVQEDVYEEFLERSAERAKRRLVGDPFDLKTEQG
PQVDLEQFNKILGYISTGKREGAKLMCGGGVAANKGYFIQPTVFGDVQDNMTIAREEIFG
PVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKAHYISNGLRAGTVWINCYDVFGAQ
APFGGYKASGIGRELGEYGLTNYTEVKTVTIRVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtaccgtgctcctccgggcccttcccaggttcggctgcccagcggtctgccgc
tactctgcggcggccatcccggtgccgaacacccagccggaggtccacttcaacaagctc
ttcatcaataatgaatggcatgacgccgtcaacggaaaaacgttccccaccatcaacccg
tccaccggggaggtcatctgtcaggtcgccgaggcggatgaggcagatgtaaacaaggct
gtgaaagccgcacgtgatgccttcaggttggggtcaccatggcgacggacggatgcctca
caccgcggcctgctgctgaaccgtctggcggacgccatcgagagggattctgcttatctg
gctgaactggagactctagataatggaaagccatatgcagttgcgtactctgtggacttg
cccaatgtggtgaagtgtttgaggtactacgcaggctgggccgacaaatgggagggaaag
accattcccattgacggagacttcttctgctacacccgacatgagcccatcggggtctgt
ggacagataattccgtggaacttccctctgttgatgcaggcctggaaacttggccctgcc
ttggcaaccggcaacaccgtggtgatgaaagtcgcagagcagacgccgttaactgctctg
tatgtggccagcctggtcaaagaggtgggtttcccagaaggggttgtgaatatcttggct
ggaatgggacccacggctggggctgcaatcgtcaggcacatggatgtcgataaagtggcg
ttcaccggatccacagaggtgggtcacctgattcagcaggcatcaggtagcagtaacctg
aagaaagtcaccctggagctgggaggaaagagccctaacatcatcctgtctgacgccaac
atggaggacgcggtggagcagtcccactttgccctgttcttcaaccaaggccagtgctgc
tgcgctggctcacgcacctacgtgcaagaagacgtctatgaggagtttttggagcggagc
gcggagcgagccaagcggcgactggttggagaccccttcgacttgaagacggagcagggg
cctcaagtggacctggagcagttcaacaagatcctgggctacatcagcacggggaagagg
gagggagccaagctgatgtgtggaggaggagtagctgcaaacaagggatacttcatccag
cccactgtgtttggagatgtacaggacaacatgaccattgccagggaggagatttttggc
ccagtgatgcagatcttgaagttcaagtcgctggaggaggtggtggaacgggccaatgac
accaaatacggtctggcagcagctgtgttcacgaaggacatcgataaggcgcactatata
tccaacggtctgcgcgcaggcactgtgtggattaactgctatgacgtgtttggggcccag
gctccatttgggggctacaaggcatcaggaatcggacgagagctgggagaatacggtctg
accaactatacggaggtcaagacggtgacaataagagttccacagaagaactcgtag

DBGET integrated database retrieval system