KEGG   Takifugu rubripes (torafugu): 101077704Help
Entry
101077704         CDS       T02386                                 

Definition
(RefSeq) histone deacetylase 4-like
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101077704
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tru03036]
    101077704
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101077704
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101077704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101077704
NCBI-ProteinID: XP_011604558
LinkDB All DBs
Position
8
AA seq 1099 aa AA seqDB search
MTSHSHQEGILGKEQPLEVLKTSVLNHIPTVDINSALPLRLPPAAIPMDLRVDPHQQQQQ
VSQLSPPGQQPPGVAGTGQSGGGGGGGGTGGPSVCDQQLQQELLTLKQKQQIQRQILIAE
FQRQHEQLSRQHEAQLQEHIKQQQELLALKHQQELLEHQRKMENHRMEQELEKQQREQKL
QLLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNQGGPHNDAPYWYRKTQHSSL
DQSSPPQTGVSTYNQPVLGVYNPRDDFPLRKTASEPNLKLRSRLKQKVSERRSSPLLRRR
DSPITTAKKRSLDMADSACSSAPGSGPSSPNNSSNNIPSENGVTVSVSNNSEVSLAQRMC
GGAERGSVNQLSLYTSPSLPNITLGLPATATATAASNVTSAQPDGGLQPALSLSPPFLSG
GHLTPYLAEAGAGTGGHAAHSPLLQHMVLMEQSPAQSPLVTGVSGLTMSPAASMAKLQRQ
HRPLGRTQSAPLPQGSAAQAHAQALALQQLVVQQQHQQFLEKHKQQFQQQQLHLNKMITK
PSESPVGRQHQSHPEETEEELREHQDGGALPAGVTIKQEPPDPQELQEEVLHRERERQAE
QQELLFRQQALLLEQQRIHQLRNYQASMEAAGLSISFPGHRPLSRAQSSPASASSFPISV
PASDPPTKPHFTTGLVYDSLMQKHQCMCGNTNNHPEHAGRIQSIWSRLQETGLRAQCECI
RGRKATLEELQTVHSEAHVLLYGTNPLRQKLDCSITPMFVRLPCGGIGVDSDTIWNEVHS
SSAARLAVGSVVELVFKVATQELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQ
RLNINKILIVDWDVHHGNGTQQAFYDDPSVLYLSIHRYDDGNFFPGSGAPDEVGSGPGVG
FNVNVAFTGGLEPPMSDAEYLAAFRSVVMPIANEFAPDIVLVSSGFDAVEGHPPPLGGYT
LTAKCFGYLTRQLMTLAGGRLVLALEGGHDLTAICDASEACLAALLGQELDPLPKSVLEQ
RPNVNAVRSLEKVLEIHSKYWRSVQRYSLHLGLSLLEAKRGDSEEAEAVSAMASLSVANT
NAMDQSRSEEEPMEEEEPL
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacacagccaccaagagggaatcctggggaaggagcagccactggaggttctg
aagacatccgtgctcaaccacatcccaacagtggacatcaactcggcgctgcccctgcgt
ctccctccagctgccatccccatggacctgcgcgtggaccctcaccagcagcagcagcag
gtgtcccagctctccccaccgggccagcagccaccgggcgtcgctgggaccggccagtct
ggtggcggcggcggaggaggtggcacgggaggcccttcggtgtgtgaccagcagctacag
caggagcttctgacactgaagcagaagcagcagatccagcggcagatcctcatcgccgag
ttccagcggcagcacgagcagctgtctcgccaacacgaggcccagctgcaggagcacata
aagcagcaacaggaactcctggcattgaagcatcagcaggagctactggagcaccagagg
aagatggagaaccaccgcatggagcaggagctagagaagcagcagagggagcagaaactg
cagctgctgaagaacaaggagagaggtcaagagagtgctgtggccagcactgaggtaaag
atgcgcctccaggagtttgttctcaacaagaagaaggccctggcacagcggagcctcaac
caaggagggccccacaatgatgccccctactggtaccgcaaaactcagcacagctccctg
gaccagagctcaccaccacagacaggtgtttccacctacaaccaacctgtgctgggcgtc
tacaatccccgggatgacttcccactgcgaaagactgcctcagaacccaacctgaagctc
cgctccaggctgaagcagaaggtgagcgagcggaggagcagtccgctgcttcgtcgtcga
gacagccccatcactactgctaagaagcgctcccttgatatggcagactctgcatgtagc
agcgcccccggctctggcccaagctccccgaataacagctccaacaatatccccagtgag
aatggcgtcacggtgtcagtctccaacaacagcgaggtttccctggcccagaggatgtgc
ggtggtgctgagcggggctccgtgaaccagctgtccctctacacctcaccatccttaccc
aacatcaccttggggctgcccgccacggctacggccaccgctgcttccaacgtgacctca
gcccagccggatgggggcctgcagccagcgctctccctcagccctccgtttctctccggt
ggccatttgactccctacctggccgaggcaggggcaggaacaggcgggcacgccgctcac
agcccgctgcttcaacacatggtgctcatggagcaaagcccagcacagagccccctggtg
acaggcgtcagcggtctgacgatgtctccggcagcgtccatggccaagctgcagcggcag
caccggcccctcgggcgaacccagtcggcccctctgccacaggggagcgcggcccaggcc
cacgcccaggccctggccctgcagcagctggtggtccagcagcagcaccagcagttcctg
gagaagcacaaacagcagttccagcagcagcagctccacctcaacaagatgattacaaag
cccagcgagagccctgtggggcgtcagcaccagagccacccagaagagacagaggaggag
ctgcgggaacaccaggacggcggggccctgccggcgggggtcaccatcaagcaggagcca
cctgatccccaggagctccaggaggaggtgctgcacagggagcgggagaggcaggctgag
cagcaggagctgcttttcagacagcaggccctgttgctggagcagcaacggatccatcag
ctgaggaactaccaggcctccatggaggctgccggcttgtcgatctccttcccaggacat
cgccctctctccagagcccagtcgtctccagcctcggcctcctccttcccgatcagcgtt
cctgcctctgaccctccgaccaaacctcacttcaccacagggctggtgtatgactccctc
atgcagaagcaccagtgtatgtgtggaaacaccaacaatcacccagaacacgcaggccgg
atccagagcatttggtcccggctgcaggagaccggactgagagcgcagtgtgagtgtatc
cgtgggagaaaggccacgctggaagagctgcagacggttcactctgaagcccacgttctg
ctctatggaacgaaccctctccgacagaaactcgattgttcaatcacgccgatgtttgta
cggctcccgtgtggcggaattggggtggacagtgacaccatttggaacgaggtccactcc
tccagtgcggctcgtctcgctgtgggatcagtggtggaattggttttcaaggtggccact
caggagctgaagaatggttttgctgtggtccggcctcctggacaccatgcagaggaaagc
actccgatgggtttctgctacttcaactccgtggccatcgcagccaaacttctgcagcag
agactcaacatcaacaagatcctcatcgtggactgggatgttcaccatggcaacgggacc
cagcaagctttctatgatgaccccagtgttctttacctgtccattcatcgctatgacgat
ggtaactttttccctggaagcggcgcacccgatgaggttggcagcggtcctggcgtcggc
ttcaacgtcaatgtggcgttcactggaggcctggagccccccatgagtgacgcagagtac
ctggctgccttcaggtcggtggtgatgccaatagccaatgaatttgccccggacattgtg
ttggtctcgtctggcttcgacgctgttgaaggacaccctccaccactcggcggctacact
ctgacagccaagtgtttcggctatctgacaaggcagctaatgacgctcgccggaggccga
ttggtcttggctctggagggtggtcatgaccttaccgccatctgtgacgcctctgaggcc
tgcttggctgcactgctaggccaggagctggacccattgccaaagtccgtccttgagcag
aggcccaatgtaaatgctgttcgttccttggagaaagttttagaaattcacagtaaatac
tggcgctcagtccaacgctactctctgcatctgggtctgtctctgctggaggccaagcgt
ggggactcggaggaggccgaggccgtcagcgcaatggcctccctctctgtggctaacacc
aacgccatggaccaaagcaggtctgaggaggaaccaatggaagaggaggaaccactgtaa

DBGET integrated database retrieval system