Takifugu rubripes (torafugu): 101077708 Help Entry 101077708         CDS       T02386                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism tru  Takifugu rubripes (torafugu) Pathway tru04010   MAPK signaling pathway tru04012   ErbB signaling pathway tru04068   FoxO signaling pathway tru04137   Mitophagy - animal tru04140   Autophagy - animal tru04150   mTOR signaling pathway tru04210   Apoptosis tru04218   Cellular senescence tru04370   VEGF signaling pathway tru04371   Apelin signaling pathway tru04540   Gap junction tru04625   C-type lectin receptor signaling pathway tru04810   Regulation of actin cytoskeleton tru04910   Insulin signaling pathway tru04912   GnRH signaling pathway tru04914   Progesterone-mediated oocyte maturation tru04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101077708 (kras)    04012 ErbB signaling pathway     101077708 (kras)    04370 VEGF signaling pathway     101077708 (kras)    04371 Apelin signaling pathway     101077708 (kras)    04068 FoxO signaling pathway     101077708 (kras)    04150 mTOR signaling pathway     101077708 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101077708 (kras)    04137 Mitophagy - animal     101077708 (kras)   09143 Cell growth and death    04210 Apoptosis     101077708 (kras)    04218 Cellular senescence     101077708 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     101077708 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101077708 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101077708 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     101077708 (kras)    04912 GnRH signaling pathway     101077708 (kras)    04914 Progesterone-mediated oocyte maturation     101077708 (kras)    04916 Melanogenesis     101077708 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tru04131]     101077708 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tru04031]     101077708 (kras) Membrane trafficking [BR:tru04131]  Endocytosis   Macropinocytosis    Ras GTPases     101077708 (kras) GTP-binding proteins [BR:tru04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101077708 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin nSTAND3 Motif Other DBs NCBI-GeneID:  101077708 NCBI-ProteinID:  XP_011605451 Ensembl:  ENSTRUG00000023449 UniProt:  A0A674N4I3 LinkDB All DBs Position 9:7178338..7186542 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLNKLSKEEKTPRC VKLRKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataagctggtagtggtgggagctggaggtgttggcaagagtgcgcttact atccagctcatccagaaccactttgtggatgaatacgaccccaccattgaggactcctac agaaagcaagtagtgattgatggagagacctgtctacttgacatcctggacactgcaggt caggaggagtacagcgccatgagagatcagtacatgaggacgggggagggcttcctctgt gtctttgccatcaacaacaccaagtctttcgaggacattcatcactatagagaacagatt aagcgggtgaaggactctgaggacgtccccatggtactggtggggaacaagtgtgacctc ccgtcccggacagttgacaccaagcaggctcaggacttggcgcgaagctacggcattccc tttattgagacctcagccaaaaccagacagagagtggaagatgccttttacactctggta cgggagatcaggcagtaccggctcaataaactcagcaaggaagaaaagactccacgctgt gtcaagcttagaaagtgtgttgtgatgtga

DBGET integrated database retrieval system