KEGG   Takifugu rubripes (torafugu): 101078470Help
Entry
101078470         CDS       T02386                                 

Gene name
pfkp
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00030  Pentose phosphate pathway
tru00051  Fructose and mannose metabolism
tru00052  Galactose metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru01230  Biosynthesis of amino acids
tru03018  RNA degradation
Module
tru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101078470 (pfkp)
   00030 Pentose phosphate pathway
    101078470 (pfkp)
   00051 Fructose and mannose metabolism
    101078470 (pfkp)
   00052 Galactose metabolism
    101078470 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101078470 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:tru01009]
    101078470 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:tru03019]
    101078470 (pfkp)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101078470 (pfkp)
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101078470 (pfkp)
Messenger RNA biogenesis [BR:tru03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101078470 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101078470
NCBI-ProteinID: XP_003967885
LinkDB All DBs
Position
10
AA seq 788 aa AA seqDB search
MAQPDGKKIFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGLYVGAKVYFIHEGYQG
MVDGGDNIREASWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITNLCVIG
GDGSLTGANLFREEWSGLLTELVEQGLIEQDSVQKYSALHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEDKMCQKLSANRAGKKRLNVIIVAEGAIDRSNTPITTDYIKDLVVKNLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQSVRLPLMECVEMTQE
VQKAMDEKRFEEAVKLRGRSFENNLKTYKLLAHRKPESDLPRSNFNVAVLNVGAPAAGMN
AAVRSAVRVGISEGHKVFAVSDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAK
HVDKIAAQMRQHNINALLIVGGFEAFESLLQLFEARATYEEFCIPMCMVPATISNNVPGT
NLSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADAAYIY
EEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKISAKAMQWVTRKLGETFRQGRVFANSEDSCCLLGMRRR
ALVFQPVVQLKGETDFIHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVHNRPK
ELDASVAM
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccggacggcaagaagatcttttttgagaacctgtctggagccgggaaagct
atcgcggtcctgacgagcggaggggatgctcaaggtatgaacgccgctgttcgcgctgtc
gtccgaatgggcttgtacgtaggagcaaaagtatattttattcacgagggatatcagggc
atggtggacggtggagacaacatcagagaagcctcgtgggaaagtgtctccagcatgcta
caagtgggtggaactgtgatcggcagcgcccgctgtaaagagttccgcacccacgagggc
cgtctgaaggccgctcacaacctggtgcagcgcggcatcaccaatctgtgcgtgatcggc
ggagacggcagcctgacgggagccaacctgttcagggaggaatggagcgggctgctgacc
gagctggtggagcagggcctgatcgagcaggattcggttcagaaatattcggccctccac
atcgtgggcatggttggctccatcgacaacgacttctgcggaaccgacatgaccatcggg
acggactcggcgctgcacagaatcatcgaggtggtcgacgccatcatgacgacggcccag
agtcaccagcggaccttcgtgctggaggtgatgggcaggcactgtggctacctggctctg
gtgagtgctctggcctgtggagccgactgggtcttgattccagaaatgcctccagaggac
ggctgggaggacaagatgtgtcaaaagctctctgcgaaccgagcagggaagaaaaggctg
aatgtcataattgtagccgaaggggcgattgatcgtagcaacacgcccattaccactgac
tatatcaaggatcttgttgtcaaaaatttgggttttgacacacgagtgaccattctggga
cacgtgcagagaggaggaaccccttctgcttttgaccgcatcctggccagtcgtatgggc
gtggaggcggttctcgccctcctggagaccacagccaacacgcccgcctgcgtggtctcg
ctgtgtggcaaccagtcggtgcgactgcctctgatggagtgtgtggagatgactcaggag
gtccagaaggcaatggacgagaagcggttcgaggaggcggtgaagcttcgaggcaggagt
tttgaaaacaacctaaagacctacaagctcctggctcatcgtaaaccagagtccgacctg
cctcgtagcaacttcaatgtggctgtgttgaacgtgggcgctcctgcggcgggcatgaac
gctgccgtccgttcagccgtccgggtgggaatctctgagggacacaaggtgtttgctgtc
agtgacggcttcgagggattctacaaaggacagataaaggagattaaatgggctgatgtt
ggaggatggacaggacagggtggatctctactggggaccaaaaggacccttcctgccaag
cacgtcgacaaaattgctgcgcagatgcgacagcacaacattaatgctctgcttattgtg
ggcggatttgaggcgtttgagagtctgctgcagctgtttgaggctcgcgccacctacgag
gagttttgcatacccatgtgtatggtgcccgccaccatcagtaacaatgttcccggcacc
aatctgagtattggggcagacaccgccctcaacgctatcgtggagacttgcgaccgcatc
aagcagtcggccagtggaaccaagaggcgcgtgttcatcatcgagaccatgggcggttac
tgcgggtacctggccagcgtcgggggcctggccgccggagccgacgccgcctacatctac
gaggagccgtttgacatcagagatctgcaggccaacgttgaacacttgacagagaaaatg
aagaccagcatccaaagaggactggtgctcaggaacgagaactccaatgaaaactatact
actgactttatctaccagctgtattctgaggagggtaaaggagtgtttgactgcaggaag
aatgtgctgggacacatgcagcagggcggcgctccatctccatttgaccgtaactttggc
accaagatctctgccaaggccatgcagtgggtgaccaggaagctgggggagaccttcaga
caaggacgcgtctttgccaacagcgaggactcctgctgcctgctgggaatgcgtcgcagg
gctctggtcttccaacccgtcgtgcaactcaagggcgagactgacttcattcacaggatc
cctaaagagcagtggtggctgaagctgcgtcctctgatgaagatcctggccaagtacaaa
accagttacgacgtgtcggactcaggacagctggagcacgtcgtccacaaccggcctaaa
gagctggacgcctctgtagccatgtga

DBGET integrated database retrieval system