KEGG   Takifugu rubripes (torafugu): 101078555
Entry
101078555         CDS       T02386                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like isoform X2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
tru04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101078555
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101078555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tru04030]
    101078555
G protein-coupled receptors [BR:tru04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101078555
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Claudin_2
Other DBs
NCBI-GeneID: 101078555
NCBI-ProteinID: XP_003972428
Ensembl: ENSTRUG00000015976
UniProt: H2UV65
LinkDB
Position
17
AA seq 359 aa
MDTLTDDTEGCYFNRSVKFFYESSGKNISDHWRKRDYTIVSLGMAVCFVVIFSNILVIAA
IIKNRRFHFPIYYLLGNLALADLFSGVSYLNMMFHTGPWTIKLSKHQWFVRQALIDTSLT
ASVLNLLAVAVERHQTIFNMQLHSEMSARRIFVVIVFIWLVAIIMGLVPTMGWHCLCDLE
NCSTMAPMYSRKYLVFWALLNLLTFSIMVAIYTHIFVYVRRKSKQMAPHTSQMRHRETVM
SLMKTVSLILGCFVLCWTPGLVVLLLDGLGCERCQVLRIEKYCLVLAECNSFVNPIIYSL
RDKDMRTTFLEILCCGSRQNRNHSSSAVHFNTMDQEKSQSAELMPRSNGTPHASDSTVS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggacacgctgacggacgacacggagggatgctacttcaaccgctccgtcaagttcttc
tatgaatccagcgggaagaacatcagcgaccactggcgtaaacgggactacaccatcgtc
tctctgggcatggccgtctgctttgttgtcatcttctccaacattttggtcatagctgcc
atcatcaaaaacagacgctttcatttcccgatctactacctgttgggtaacctggctctg
gcagacctcttctcaggcgtctcctacctcaacatgatgtttcacacgggtccttggacc
attaagctctccaagcaccagtggtttgtgcggcaggctctgatcgacaccagcctgacg
gcctcggtgctgaacctcctggccgtggccgtggagcgccaccagaccatcttcaacatg
cagctgcacagcgagatgagcgcccggcgcatctttgtggtcatagtcttcatctggctg
gtggccatcatcatgggcctggttcccaccatgggctggcactgcctgtgtgacctggaa
aactgctccaccatggcgcccatgtacagccgcaagtacctggtcttctgggctctgctc
aacctgctcaccttctctatcatggtagccatctacacccacatttttgtctacgtgagg
cgcaaaagtaagcagatggcgccgcacaccagccagatgagacacagggagacggtgatg
agcctgatgaagacggtgtcgctcattctgggctgtttcgtgctctgctggacgccgggt
ctggtggtcctgctcctggacggcctgggctgtgaaaggtgtcaggtgctgcgcattgag
aagtactgcctggtgctggccgagtgcaattccttcgtcaaccccatcatctactcgctc
agagacaaagacatgaggaccacctttctggaaatcctgtgctgtggctcccggcagaac
aggaaccattccagctctgccgtccacttcaacaccatggaccaagagaagtctcaatcc
gccgagctgatgcctcggagcaacgggacgcctcacgccagcgattccaccgtctcttag

DBGET integrated database retrieval system