KEGG   Takifugu rubripes (torafugu): 101079162
Entry
101079162         CDS       T02386                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101079162
   04068 FoxO signaling pathway
    101079162
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101079162
SSDB
Motif
Pfam: CDI SR-25
Other DBs
NCBI-GeneID: 101079162
NCBI-ProteinID: XP_003972984
Ensembl: ENSTRUG00000022634
UniProt: A0A3B5K970
LinkDB
Position
18
AA seq 181 aa
MAMVSIPTAEPAMAREISRLGGVEALNMKVGPVRRNLFGPVDHDQLQQDFERLLRMSVEV
ANKRWDFDFQNEKPGRGAGVEWEELSCQDVPAFYRSCLVRAAPLPPSKRRTSSSSSSPYS
SSGESSPGSSSSPGTSDQYLDVTRKGCYRVRRQRKRRQPAITEFFRVKKRKLLYYKESSR
Q
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcgatggtctctatacccacagcagaaccagcgatggcgcgtgaaatttcccgcctg
gggggcgtcgaggccttgaacatgaaggtggggccggtacggaggaacctctttgggccg
gtggaccacgaccagctccagcaggactttgagcggctgctccgcatgagcgtggaggtg
gccaacaagcgctgggactttgatttccaaaacgaaaagccaggtcgtggcgccggcgtt
gagtgggaggagcttagctgccaggacgtgccggccttttaccgcagctgcctggtgagg
gcagcaccgctcccaccgagcaagaggcggacgtcgtcctcgtcgtcctcgccgtattca
tcgtccggagagagctccccggggtccagcagttcgccaggaacctccgatcagtacctg
gatgtgaccaggaaagggtgctacagagtcaggcggcaaaggaagcgcagacagcccgcc
atcacagaattcttcagggtgaagaagaggaagcttctgtattacaaagaatcctcccgg
cagtag

DBGET integrated database retrieval system