KEGG   Takifugu rubripes (torafugu): 101079536Help
Entry
101079536         CDS       T02386                                 

Gene name
gys2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
tru04910  Insulin signaling pathway
Module
tru_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101079536 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101079536 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tru01003]
    101079536 (gys2)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101079536 (gys2)
Glycosyltransferases [BR:tru01003]
 Polysaccharide
  Storage polysaccharide
   101079536 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101079536
NCBI-ProteinID: XP_003972667
LinkDB All DBs
Position
18
AA seq 708 aa AA seqDB search
MPLPRSVSMTSLSGLLPAWEEDPLPVEELLLFEVAWEVTNKVGGIYTVIQTKAKVTVDEW
GENYFMMGPYFEHNFKTQVEACEPPNQAIRKAMDALLHNGCQVYFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWQTCSIGLPYHDREANDALILGSLIAWFFKELTDQLGDKPNVIGH
FHEWQAGPGLILSRSRKIPLATVFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGDRQI
YHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHS
TNKVHIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFIESLSRLNYLLRVHRN
DVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKEKFGKKLYDALLKGEIPDMNS
ILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSADPILSNIRRISLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSAEESCNQLTQFMFTFCQQSRRQRIIQRNRTERLSDLLDW
RYLGTFYMHARHLALSRAFPDKFKMEQVAPLKTEGFRYPRPYSVPPSPSASLHSTPHHSD
VEDDDDDDDGEPYNEEEEAERDRLNIKAPFVLGAVPEGKKKQPGESGN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccgcgctccgtatccatgacatctctgagcgggctgctgccggcctgggag
gaggacccgctgcctgtggaggagctgttgctctttgaggtggcctgggaggtcaccaac
aaagtcggaggcatctacaccgtgattcagacaaaagccaaagtcactgtggacgaatgg
ggcgagaactacttcatgatgggaccctactttgaacacaacttcaagacccaggtggaa
gcctgtgagcccccaaaccaggccatcaggaaggccatggacgcgctgctccacaacggc
tgtcaggtatattttggccgatggctgatagagggcagcccgtatgtgatcctcttcgac
atcggttctgcagcctggaacctggaccgctggaagggcgacctgtggcagacctgcagc
attggcctgccctaccacgacagagaggccaatgacgcgctcatcctgggctctcttatc
gcctggttcttcaaagagttaacagaccagttgggagacaagcccaatgtgattggtcat
ttccatgagtggcaggcaggtccgggcctcattctatcccgttctcgcaagatccctctg
gcgactgtcttcaccactcacgccaccttactgggacgatacctctgtgctgggaatgct
gacttttacaacaatctggacaagtttgacattgacagggaggcaggagacaggcagatc
taccaccgttactgcctggagagggcggcggttcactgtgctcatgtcttcaccacagtg
tctcagatcactgctgtggaagccaaccacatgctacacaggaagccagatgtggtgact
cccaacggtctgaacataaagaagttctcagcaatgcacgagtttcagaacctgcactcc
accaacaaagtccacatccaggagtttgtcagaggacacttctatggtcacctggatttc
aacctggagaagactctcttcttcttcattgctggacgttatgagttttccaacaagggg
gctgatctgttcatcgaatccctgtccagactgaactacctgctgcgggtccacaggaat
gatgtgaccgtggtagtcttcttcattatgccggctaagaccaacaactttaacgtggag
tcactgaagggtcaagcagtacgcaaacaactttgggacacggcccacacggtgaaggag
aagtttggcaagaagctgtatgacgctctgctaaaaggggaaatccctgacatgaactcc
atcctggaccgagatgatttcaccatcatgaagagagccatatacgccactcagagacat
agtctccctccagtcaccactcacaacatgctggacgactcagcagatcccatcctgtcc
aacatccgacgtatcagcctcttcaactccagaaacgatagagtcaagatcatcttccat
ccggagtttctgtcctccacaagtcctctgctccccatggactatgaagactttgttcgt
ggttgtaacctgggagtgttcccctcctattacgagccgtggggatatacacctgctgag
tgcacggtgatgggaattcccagtgtcaccaccaacctttctggttttggctgcttcatg
gaggagcatgtctcagaccctgcagcctacgggatttacatcgtggaccgtcgcttccgc
tccgcagaggagtcgtgcaaccagctgactcagttcatgtttaccttctgccagcagtcc
cgccgccagcgcattattcagcgcaacaggaccgagaggctctctgacctgctggactgg
agatacctgggaacgttctacatgcacgctcgacatctggcactgagcagggcattccca
gacaagttcaagatggagcaagtggctcctctgaagacagagggcttccgctaccctcgg
ccctattcggtgcccccctccccttctgcctccctccactccaccccccaccatagtgat
gtggaggatgatgatgatgacgatgatggtgagccctacaacgaggaggaagaggctgaa
agagaccgactaaacattaaggctccctttgttctcggtgctgttccagagggcaagaag
aagcaaccaggagagtctggaaactaa

DBGET integrated database retrieval system