KEGG   Takifugu rubripes (torafugu): 101079817Help
Entry
101079817         CDS       T02386                                 

Gene name
dcc
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  deleted in colorectal carcinoma
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Neogenin_C I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_4 Ig_5 Ig_6 EphA2_TM Protocadherin FAM176 Arylsulfotran_N Shisa Herpes_UL74 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 101079817
NCBI-ProteinID: XP_011602745
LinkDB All DBs
Position
6
AA seq 1431 aa AA seqDB search
MTRCVLRCTTFSPPPTGSDTFSSPSSSSSLGSFMEFTFSQEPQDTVTVQGGTLQLDCQAQ
SDAVAEPPSIAWRKDGVLLSTMVDERRQQLANGSLLVQNVMHSRHHRPDEGEYQCLATLD
GLGSIVSRVARVSVAGPLKVVIPTKSVSTYLGDTALLECKVSGDPSPVIRWQKNREDLPV
TFDPNSHLAMLPSGSLQVSRVQPPDSAMYRCLADNPGSSRTGSDAELRVLPEPGLPRSLQ
FLQRPSKVTALLGTDVVLECSVSGYPTPSIQWRKGEELIQSWNKKYSLLVGSNLLIRSVT
DDDSGSYSCTAANRNQNITAQAELGVLVPPQFLNYPTNTFAYESTDIELECAVTGNPPPT
VRWVKNGEEVIPSDYFQIVDGSNLQILGLVKSDEGFYQCVAENSAGSSQAMAQLLLREPV
SPSPGAALPSPPRDLVPVLVSSRFVRLSWRPPEETGGGVQTYGIYYSQDGVERERSVNVS
EPESLELMVSNLKPEETYSFRVIAYNDVGPGESSAPLKITTKPDLQVPSRVESLRPVALS
PTSVQVSWGPPSHPNGPILGYRLLWTESPSGKEQSVEVNGLSYKMDGLNKFTEYTVRVLA
INRYGPSPATDAASVTTHSDVPSAPPQNITLEVVLSRSIKVLWQPPPRSSQNGIITAYKI
KYRRTGRRGDQEAIEPNNFWYLFTGLEKGSQYSFQVAAMTANGTGPFSDWSTAETPENDL
DESQVPDQPSSLHVRPLPHSIIMSWTPPLSPNILVRGYIIGYGVGSPYAETVRVDSKQRY
YSIENLEPSSHYVISLKAFNNAGEGIPLYESAVTRSLTDPIDPSEDDLFHLFDKYPTPMP
DTSTPMIPPVGVQAVALSSDSVRVSWADNSMSKNQKTSEVRYYSVKWKTSYSTSGKYKSA
DTTALSHTVTGLKPNTMYEFAVMVTKGRKSSTWSMTAHATTYEAAPGSAPKDLTVISREG
RPRSILISWQPPMEANGRLTGYILYYTLDKNMPIDDWVMEAISGDRLTHQVVDLNLDTVY
YFRIQAKNAKGVGPLSEPIHFRTAKVEHPDKMANDQGRGGEPGYWPPDTSLIDRSSINDS
PIGQMRPPHGSVTPQKNSNLLVIIVVSVGAVTVVVVVVVALICTRRSSAQQRKKRASHSA
SKRKGSQKDLRPPDLWIHHEEMEMKNMEKAPSVAPSGHDSPIQSCQDLPQVAHSQSESQI
GSKSSHSGGDGDEASSSISTLERSLAARRGTRGKMMIPMDTQPSNTPVVSAIPVPALDSS
QYSGILPSPSCGFTHNKFSLRPMPFSTLTVDRGFTTVPGAPAPVVPAPAEEVQAASGRTI
PTACVRPSHPLRSFTNPLLPSSMGTIDPKVYTSMMPQSSASLPKPQVKTASLGQPGKARS
PLLPVSVPTAPDLAEEGATKAAEDSAANITVFMVGEYEGKMKEEGCLAKEG
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctgtgtcttacgttgtaccaccttctctccacctcctacaggatcagatacc
ttctcttctccctcctcttcatccagcttgggaagttttatggaattcaccttctcccag
gagcctcaggacacagtgacggtgcaaggagggacgctgcagctggactgccaggcacag
tcagacgcagtggcggagcctccctccatcgcatggcgcaaggacggtgtgttgctaagc
acaatggtagacgagaggcggcagcagcttgcaaatggttcactactggtgcagaatgtg
atgcattcacgacaccaccggcctgatgaaggggaataccagtgcctcgccacgctggac
ggactggggagcattgttagccgcgtagccagagtcagtgtggctggtccccttaaggtt
gttattcccaccaagtctgtgtctacctaccttggcgacacagctctactggaatgtaag
gtctcgggtgacccatcacctgtgatccgctggcagaagaaccgagaagacctgcctgtg
accttcgaccccaattctcatctagcgatgttaccatctggctcactgcaggtcagccgt
gtccagccccccgactcggccatgtatcggtgtttggcagacaatcctggcagcagcagg
acaggaagtgatgcagaactccgagtccttccagaaccaggtctgcctagaagtcttcag
ttcctccagcgtccctccaaagtaacagctctgctgggaacagacgtggtgctggaatgt
tctgtctctggatacccaacaccgagcattcagtggagaaaaggagaggagctcatccag
agctggaataagaagtattctctgctggtcggcagtaatctgctcatccggagcgtcact
gacgatgactcgggcagctacagctgcacagctgccaacaggaaccagaacatcactgca
caggctgagctgggtgtcctcgtgccacctcagttcttgaattatccgaccaacactttt
gcctacgagtctacagacatagagcttgagtgtgctgtcacaggaaacccccctccaaca
gtccgctgggtgaaaaatggagaggaagtcatacccagtgactacttccagattgtggat
ggaagcaacctgcagattttgggtttggtgaagtcagatgaagggttctatcaatgtgtg
gccgagaactctgctggcagctcccaagctatggctcaactgctgctccgagagccagtg
tcccccagcccaggcgctgccctcccctctcccccgcgtgacttggtccctgtcctagtg
tccagccggtttgttcgactcagctggcgccccccagaggagactggaggtggtgtgcag
acctatggcatctattactcccaggatggagttgagagggaacggtcagtaaatgtgtcg
gagccagagtctttggagttgatggtgtccaacctcaaaccagaggagacctacagcttc
agagttattgcttacaacgatgtgggaccgggagaaagttctgcccccttgaagatcacc
accaaacctgacctgcaggttcccagtagagtggagtccctccgacccgtggctctgtcc
cccacctcagtccaggtgagctggggccctcccagccacccaaacggccccatcctgggt
tacagactgctctggacagagagcccctcgggcaaggaacagagtgtggaggtgaatgga
ctcagctacaagatggatggactcaataagttcacagagtacacggtgcgagtgctagca
atcaaccgctacggacccagtcctgccacagacgccgccagcgtcaccacccactcagac
gtacccagcgctcctcctcagaacatcaccttagaagtcgtcctgtcaaggagcatcaag
gtgttgtggcagccgcctccacggagctcccagaacggcatcatcactgcctacaaaatc
aaatacaggaggacaggtcgccgtggtgaccaagaggccattgaacccaacaacttctgg
tacctttttacaggtctggagaaaggcagccagtacagcttccaggtggcagccatgaca
gctaacggaacaggtccatttagcgactggtccactgctgagacgccagagaacgatttg
gacgaaagtcaagtacccgatcagccaagttctctgcacgtcaggccactgccccacagc
atcatcatgtcttggacgccaccgctcagccccaacatcctggtccggggctacatcatt
ggctacggggtgggcagcccctatgctgagacggtccgcgtggacagcaagcagagatac
tattccattgagaacctcgagcccagctcccactacgtgatctccctgaaagccttcaat
aatgccggagaaggaatcccgctgtacgagagtgctgtcacacgatccctgacagacccc
atagacccatctgaggatgatctcttccatctctttgataaataccccactcccatgcca
gacaccagtactcccatgattcccccagtgggggtccaagcggtggctctgtcgtcagat
tcggtccgggtttcttgggctgacaactccatgagcaagaatcagaagacctctgaggtg
cgctactactccgtcaagtggaagacaagctactccaccagcggaaagtacaagtccgca
gacaccacagcactcagtcatactgtcacaggcctcaaaccaaacaccatgtatgagttt
gctgtcatggttaccaaaggtcggaagtccagtacctggagtatgacggcacacgccaca
acttatgaagctgctcctggctccgctcccaaagatttaacagtgatcagtcgtgaagga
cgaccccggtctattttaattagttggcaacctccaatggaggccaatggaagactcaca
ggttacattctgtactacactctggataagaacatgccgatagatgattgggtaatggag
gccatcagcggtgaccggttgacccatcaggttgtagatttgaacctggacacagtttat
tacttcaggatccaagccaagaacgccaaaggtgttggcccattgtcagaacccatccac
ttcaggactgcaaaagtggaacatccagacaaaatggccaatgatcaaggtcgagggggg
gagcctggctactggccaccagacacaagtttgattgacagaagcagcataaatgactct
cccattggtcagatgcgtccgccccacggcagtgtcacgcctcagaagaacagcaacctt
ttggtcatcattgtggtctctgtcggagccgtgaccgtggtggtggtggtggtggtggcc
ttgatctgcacgcgtcgttcttcagctcagcagaggaagaagagagcgagccacagtgcc
agcaaaagaaaaggcagccagaaggacctgaggcctcctgacctctggatccaccatgaa
gagatggagatgaagaacatggagaaagcccccagtgtcgccccatccggtcacgactcg
cccatccagtcctgccaggacctcccccaggtggcacacagccaatcagaaagccagata
ggcagcaaaagcagccactcaggaggagacggggacgaggcgtccagcagcatctccacg
ctagagcgctccctggctgccaggaggggaacacgaggcaaaatgatgattcccatggac
acacagccaagcaacacccctgtggtcagtgccatcccagtgccagcgctggattcctcc
cagtattctggaatcctgccttcaccatcctgtggtttcacccacaataagttcagcctg
agaccgatgcctttctccactctgacagttgatcgaggattcacaacagttcctggagct
ccagctccggtggtgccggctccagctgaagaggtccaggctgccagcggcaggaccatc
ccgacggcatgcgtgcggccgagccaccctttacgaagcttcaccaacccactgttgccc
tcatccatgggcaccattgaccccaaggtgtacacttccatgatgccgcaatccagtgcg
agtcttccaaagccgcaggtaaagacggcctctctgggccagccaggaaaggcccgctct
cctctgctgcccgtctcagtgcccaccgcccctgatttggcagaagagggagcaacaaaa
gctgctgaggattctgctgccaacattacagtgttcatggtaggagagtatgaagggaag
atgaaagaagaaggttgcttagccaaagagggatga

DBGET integrated database retrieval system