KEGG   Takifugu rubripes (torafugu): 105417782
Entry
105417782         CDS       T02386                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105417782
   04068 FoxO signaling pathway
    105417782
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105417782
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105417782
NCBI-ProteinID: XP_029681133
LinkDB
Position
18
AA seq 183 aa
MCNKMSDVRLSNASPTLERVDARQPDNVTAPVRRNLFGSPDRGEIRRYLTAAIQEGVQDF
MEEYNFDPDSERPLTPHNYEWQEDNDAPEFYRRPPHRRESPRRDVEPSGDDRLEADGRQR
SENSSRKRRSAESGSCVDESRSKRTHTDEDEDDDKGQGISAGAQERRAAEGGPTSGENSA
QAQ
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaatgcgagcccgacattggagagggtg
gatgcgcggcagccggacaacgtcacagctcccgtccggagaaaccttttcggctcacct
gaccgcggtgaaatacggaggtatttgacggccgcgatccaggaaggtgtgcaggatttc
atggaggagtacaatttcgaccctgacagcgagcggccgctcacgccgcacaattacgag
tggcaggaggacaacgacgcaccggagttctatcgcagaccgcctcacaggagagagagc
ccgcggcgggatgtggagccgtccggggacgacaggctggaggcggacggtcgccaaagg
agcgagaacagcagcaggaaaaggcgttctgcggaatcaggttcgtgcgtcgacgagagt
cggagtaaacggacgcacaccgacgaggacgaggacgacgataaaggtcaggggatcagc
gcaggagctcaggagagaagagcagcagagggggggccgaccagcggggagaacagcgca
caggcccaatga

DBGET integrated database retrieval system