KEGG   Takifugu rubripes (torafugu): 105417819
Entry
105417819         CDS       T02386                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04110  Cell cycle
tru04115  p53 signaling pathway
tru04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105417819
   04068 FoxO signaling pathway
    105417819
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105417819
   04115 p53 signaling pathway
    105417819
   04218 Cellular senescence
    105417819
SSDB
Motif
Pfam: CDI YlmH_RBD
Other DBs
NCBI-GeneID: 105417819
NCBI-ProteinID: XP_011612124
Ensembl: ENSTRUG00000022950
UniProt: A0A674NZN3
LinkDB
Position
19
AA seq 193 aa
MFTSYNLKRNTTTNFIRQKATLFPDLTANCCRIMASHKRILGTLGNGPVRRNLFGPVDRD
QLQVEYRAALRKDLEDASNRWGFDFISDKPMENSDFLWEGVPGSKVPLLYRSSTPTPPQP
QRAAEPKVSRVSASSNGKENIPCSPETCPLDMGSLEKTPEKRESTGLKRKQTNITDFYQA
KRRVVGMPRKSGE
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtttacatcttacaacttgaaaagaaatactactactaacttcattcggcaaaaagca
acacttttcccggatttgacagcaaattgttgcagaattatggccagccacaagcgcatc
ctgggcaccctggggaacggccctgtccgacgaaacctcttcggtccagtggaccgggac
cagcttcaggtggagtaccgggctgccctgaggaaagacctggaggacgcttcaaaccgc
tggggcttcgacttcatctctgacaaacccatggagaacagcgacttcctgtgggaaggc
gtcccaggaagcaaggtgccgctgctctacagatcctccacgcccaccccgccgcaaccg
cagagggcggccgagcccaaagtcagcagggtctcggcatcgtctaacgggaaggagaac
atcccgtgttcaccagagacatgcccgttggacatggggagcctggagaagacgccagag
aagagggagagcacggggctgaagaggaaacagaccaacattacagatttctaccaggct
aaaagacgagtcgttgggatgccccgcaaatccggcgagtga

DBGET integrated database retrieval system