KEGG   Takifugu rubripes (torafugu): 105419238Help
Entry
105419238         CDS       T02386                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
tru04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105419238
   00500 Starch and sucrose metabolism
    105419238
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105419238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    105419238
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105419238
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105419238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal_mutarotas_2 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 105419238
NCBI-ProteinID: XP_011618986
LinkDB All DBs
Position
Un
AA seq 221 aa AA seqDB search
MNTTVAPLLFADQYLQLSTTLASHLVSGLGQHYSSLLLDVNWTTLALWNRDMAPHADANL
YGSHPFYIVQEGDGMAHGVFLLNSNAIEVILQPTPALTWIALGGILDLYVFLGPDPQMLK
KDKNVIHNLYFRPAFLPDPNDGSLYSLGGKNSEGLTKLPFTIPELVQASPCRSSDGVLYM
GKKQDLWYVVDLLTGEKQQTLTSSFAEMLCPSSSLLYLGRT
NT seq 664 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccgtcgctcctctgctgtttgccgaccaataccttcagctctccaccacg
ctcgcctcccatcttgtgtcaggtcttgggcagcactattcctccctcttgctggacgtc
aactggacaactctggctctctggaacagagacatggcgccacatgctgatgccaatctt
tatggctcccatccattctacatcgtacaggaaggggacgggatggcacatggagttttc
cttctcaacagcaacgcaattgaggtgatattgcagccgacccctgctctcacctggata
gctcttggaggaatcctggatctttacgtcttcttgggccctgaccctcaaatgctaaag
aaagataaaaatgtcatccacaacctttatttcagaccagcgttcctgcctgaccccaat
gatggcagcctgtactctctgggaggaaagaacagcgaaggcctcacaaaattgccgttc
accatccctgagctggtgcaagcgtctccctgtcgcagctcggacggcgttctttacatg
ggcaagaagcaggacctgtggtacgtcgtggatctgctgactggcgagaaacagcagacc
ctgacctcctccttcgccgagatgctgtgtccgtcctcctccctcctctacctgggacgc
acag

DBGET integrated database retrieval system