KEGG   Takifugu rubripes (torafugu): 105419288Help
Entry
105419288         CDS       T02386                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
tru04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105419288
   00500 Starch and sucrose metabolism
    105419288
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105419288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    105419288
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105419288
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105419288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105419288
NCBI-ProteinID: XP_011619067
LinkDB All DBs
Position
Un
AA seq 312 aa AA seqDB search
MLKVIGSLLLFTLTFLPYLYFHQFYNDTMVFLPGRAKQDRTSTHNDTIKYNNSVKLQRAM
HRGRSRVNDFSRDPECTMAPDSRFDCARDKAVSQSECEQRGCCYAPGSDSAGPPWCFYPG
LYRGYRMGPLMPTLHGLTATLTRAAPSDLPRDISVLQLDVTEEATDCLRITMKDPSSPRY
EVELPAVVVREETDAEDLLYTTEYQPDPFGFIVRRKTNGRVIMNTTVAPLLFADQYLQLS
TTLASHLVSGLGQHYSSLLLDVNWTTLALWNRDMAPHVDANLYGSHPFYIVQEGDGMAHG
VFLLNSNAIGTN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggtaatcgggagtctgcttctcttcactctgactttccttccttatttatac
ttccaccagttttataatgacaccatggtgtttttaccaggccgtgctaaacaagacaga
acaagcacacataatgacacaattaaatacaacaattcagttaaactgcaaagagcaatg
caccgcggcaggtccagagtgaacgatttttccagggatcctgaatgcaccatggcccca
gacagccggtttgattgtgccagagacaaagctgtcagtcagtcagagtgtgaacagagg
ggctgttgttatgcccctggatcagactctgcaggtccaccttggtgcttctaccccggg
ttgtatcgaggttatagaatgggtccgctcatgcccaccttgcatggcctgactgccacc
ttgacccgggcagccccctctgacctacccagagacatctcggttctgcagctcgacgtt
acagaagaagctacagactgtttacgcatcactatgaaggatccatcgtctccacggtat
gaagttgagctcccagccgttgttgtcagggaagaaacagacgccgaagaccttctctac
actacagaatatcagcctgacccatttggcttcatagtgcggcgaaaaacgaatggacga
gtcattatgaacaccaccgtcgctcctctgctgtttgccgaccaataccttcagctctcc
accacgctcgcctcccatcttgtgtcaggtcttgggcagcactattcctccctcttgctg
gacgtcaactggacaactctggctctctggaacagagacatggcgccacatgttgatgcc
aatctttatggctcccatccattctacatcgtacaggaaggggacgggatggcacatgga
gttttccttctcaacagcaacgcaattggtaccaactga

DBGET integrated database retrieval system