KEGG   Takifugu rubripes (torafugu): 115247210Help
Entry
115247210         CDS       T02386                                 

Definition
(RefSeq) uncharacterized protein LOC115247210
  KO
K21099  MARVEL domain-containing protein 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    115247210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tru02000]
    115247210
Transporters [BR:tru02000]
 Other transporters
  Pores ion channels [TC:1]
   115247210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4499 MARVEL
Motif
Other DBs
NCBI-GeneID: 115247210
NCBI-ProteinID: XP_029684042
LinkDB All DBs
Position
20
AA seq 288 aa AA seqDB search
MSQPHRSNRGNRERNGEHRRSREPSPDRSSSRPPYFPREADLPPRHVRDARQAEHQGSKC
TNICSRRGIVLICAVLTNSLVLICVVAAQLVTSGLSSAAGLGGFDINSNFNLQGTELQQA
RDLDMQYSQMRAPGIYGGITFSLTLGVVSLLFVVAGNKPPQLMSWKLLLGALVFQAAGAV
AYVAAVGLYLHFVIGVNATDVCKQRERIYARNGYTWMTCDVSGADAAVALFGLITAILYG
VGVVLTVQTIRRVKRHHQERKRREADKQRGRGRGRPQSAPLRAETTSV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaccccaccgttcaaaccgggggaaccgggagaggaacggagagcaccgacgc
tccagggagccgtccccggacaggtcttcctctcgacccccgtacttcccccgagaagca
gacttgccccccagacatgtgcgggacgcccgtcaagcggagcaccagggctctaaatgt
actaacatctgctccaggagaggcatcgtgttgatctgcgctgtcctgaccaacagcctg
gtcctcatctgtgtggtcgcggcccagttggtgacgtcgggcctgtcctcagccgctggg
ctcggcggctttgacatcaactccaactttaacctgcagggcaccgagctgcagcaggcc
cgggacctggacatgcagtacagccagatgagggcgccgggcatctatggcggcatcacc
ttcagcctcacactgggggtggtgtccctgctcttcgtggtggctgggaacaaacccccc
cagctgatgtcctggaagcttctgttgggggcgctggtgttccaggcggcgggggcggtg
gcgtatgtggcggccgtggggctctacctgcacttcgtcatcggggtcaacgccacagac
gtgtgtaagcagcgcgagaggatctacgcacgcaacgggtacacctggatgacctgtgat
gtcagcggggcggacgcagccgtggcgctgttcgggctcatcacggccatcctgtacggc
gtcggggtcgttctgacggtccagaccatccggcgagtgaagcgtcatcaccaggagcgt
aaacgcagagaggcggacaaacagcgaggccgaggccgaggccggccacagagcgccccc
ctgagggcagagaccacctcggtgtga

DBGET integrated database retrieval system