KEGG   Takifugu rubripes (torafugu): 115247248Help
Entry
115247248         CDS       T02386                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 3A-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tru04040]
    115247248
Ion channels [BR:tru04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   115247248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 115247248
NCBI-ProteinID: XP_029684254
LinkDB All DBs
Position
20
AA seq 462 aa AA seqDB search
MGGYGAMLNCTSPTPRSLVADLEKDLFPYRQVRPVKDFSSPLNITLDITVVGVLGVDLIS
QTLTMLIWQVLEWDIDGLSWDVQECGTEKVSVLRESIWVPDVHIAEFMEEDKSPRTPYVY
LYNTGGVFDDRPIRVVSSCKLDIYTFPFDIQNCTLTFGSYVHFASEIRMSQGSTAEDVLQ
ESREVFETNGEWDLADIQAVPFTLSLGEDDYLEIKYFLILRRKPLNYVVNLLIPSCFLVT
IDIFSFMLPPHSVDRSSFKMTLILGYTVFLLIMNDLLPVTGNQTPLINVFFSVSLALMVA
SLLETVLITHIQLGSSHGAIPDWLRTLVLQYMAILVCLPPLKKKRAVTVFLNPSATGTGV
SEPASPVAGVVSVRGPQELSDASPAEKTTQDSVLEELRKLSRHLAAIRVQVDKHFQGNHS
MQEWEMIGRVVDRFLFGLYIIFITVTFITIIAIWIWNNSYVA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggaggttatggtgccatgctgaactgcaccagcccgacccccagatctctggttgcg
gacctggaaaaagatctatttccgtaccgtcaggtccgtcccgtgaaggacttttcatct
cctctcaacatcaccttggatataactgtggtgggagttttgggagtggacctaatatcc
caaaccctgaccatgcttatctggcaggttctggaatgggatattgacggactgagctgg
gatgtgcaagaatgtggaactgaaaaagtttctgtgcttcgtgagagtatttgggtccca
gatgtgcacattgcagagttcatggaagaggacaaatctccaagaactccttatgtgtac
ttatacaacacgggtggtgtattcgatgacagacccatcagggtggtcagctcctgcaaa
ctagacatctacacttttcccttcgacatccaaaattgcactctgacctttgggtcctat
gtgcatttcgcttcagagatcagaatgagccaaggctcaacagctgaggacgtcctgcag
gagtccagagaggtgtttgagacaaacggggagtgggatcttgcagacattcaagcagta
cctttcactctttcgctgggagaagacgattacttggagattaaatattttctcatcctg
aggcgtaaacccctcaactatgtggtgaacctgctgatccccagctgcttcctcgtcaca
atcgacatctttagcttcatgttgcccccccacagtgttgaccgctcctccttcaagatg
accctcatcctgggttatactgtcttcctgctcatcatgaacgacctgctgcccgtcacc
gggaaccagacgcctctgatcaacgtcttcttctctgtcagcctggctctgatggtggcc
agcctgctggagactgttttaatcactcatatccagttaggttcctcccacggtgccatc
cccgactggctcaggaccctggtgctacagtatatggccatcttggtttgtctccctcca
ttaaagaagaagagggcagtcactgtcttcctcaacccatcagctactggcacaggagtc
tcagaaccagcttcgcctgttgccggcgtcgtctctgtcagaggccctcaggaactgtca
gacgcttctcctgcggaaaagacgacccaggactcagttttggaggaactgaggaagctg
agccgacatctcgccgccatccgcgtccaggtggacaaacacttccaggggaaccactcg
atgcaggaatgggagatgatcgggagggtggtagaccgtttcctctttggtctttacatc
atcttcatcacagtcaccttcatcaccatcatcgccatctggatctggaataattcatat
gtagcttga

DBGET integrated database retrieval system