KEGG   Takifugu rubripes (torafugu): 115250748
Entry
115250748         CDS       T02386                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115250748 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tru04052]
    115250748 (epo)
Cytokines and growth factors [BR:tru04052]
 Cytokines
  CSF and other factors
   115250748 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 115250748
NCBI-ProteinID: XP_029696490
LinkDB
Position
8
AA seq 204 aa
MANRRTSGPNRDDSERGYADTAMEFPRLLAFLLIVLEWTQPSLPSPLRPICDLRVLNHFI
KEAQDAEAAMKLCSEGCTLSDSVIVPQTTVEFDVWEKKSALAKAQEVQSGLWLLQEAFNF
LRTSVTNTALHSHIDNSVRNLLSVNAVLRSLNIQEFTPPASAAEIEGTWRVSTATELLQV
HINFLRGKVRLILLDAQACQQDVS
NT seq 615 nt   +upstreamnt  +downstreamnt
atggccaatagacggacctctgggccaaaccgggacgactctgagagaggctatgcggac
accgctatggagtttcccagattgcttgccttcctgttgatcgtgttggagtggacccag
ccaagcctgccatccccactgaggcctatttgtgacctgagagtcctgaaccattttatc
aaggaggcacaagacgcagaagcggccatgaagttgtgtagtgagggatgtaccctgtca
gattccgtgattgttccccaaacaacagttgagtttgatgtctgggagaagaaaagcgca
ttagctaaagcccaggaggtgcagtccggcttatggctcttgcaggaggccttcaacttc
ctgaggacgtcggtcaccaacacggccctgcacagccacatcgacaactctgtccgaaac
ctgctcagcgtcaacgccgtgctgcgcagcctcaacatccaggaattcacaccaccagcc
agcgcggcggagattgagggaacatggcgggtatccacggcgacagagctgctccaagtc
cacatcaacttcctgcggggcaaggtgcgcctcatcctcctggacgcgcaggcctgtcag
caagacgtcagctga

DBGET integrated database retrieval system