KEGG   Treponema sp. OMZ 804: GWP43_01335
Entry
GWP43_01335       CDS       T06435                                 

Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00270  Cysteine and methionine metabolism
trz00620  Pyruvate metabolism
trz00640  Propanoate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_01335
   00620 Pyruvate metabolism
    GWP43_01335
   00640 Propanoate metabolism
    GWP43_01335
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GWP43_01335
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     GWP43_01335
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   GWP43_01335
  Exosomal proteins of breast milk
   GWP43_01335
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C DAO ThiF NAD_binding_8 Sacchrp_dh_NADP 3HCDH_N UDPG_MGDP_dh_N ApbA Thi4 NAD_binding_7 F420_oxidored Rossmann-like Shikimate_DH Glyco_hydro_4C IlvN PglD_N Pyr_redox K_oxygenase
Other DBs
NCBI-ProteinID: QHX42312
UniProt: A0A6P1Y058
LinkDB
Position
complement(292838..293785)
AA seq 315 aa
MDQKKRKVTIVGAGSVGATFAYALAQSGFADEIAITDMNKNFAEGQAMDLVHGLPFLPQV
DIHAGGQNDYTDSDIIVITAGAKQQPGETRIDLLKRNATIIKTIAKEIAASGCKGVMLLV
SNPVDILTKVALEASGWDRGRVIGSGTVLDTARFRYVLSKECGVDARNIHGYILGEHGDS
EFAAWSMTTIAGRRIDEYCGHGVCSSGIHFDKEKILDEVRHSAYHIIDYKGSTYFAVGLA
LTRIAGAILRNERSILSVSTALNGEFGLHDACLSVPCIVGRNGVDRIIEGELPADEQSAL
ESSARRLYDAYLSIC
NT seq 948 nt   +upstreamnt  +downstreamnt
atggatcaaaagaaacgaaaagtaacgattgtcggtgcgggctctgtcggggctacattt
gcctatgcgttagctcaaagcggttttgccgatgagattgcaataaccgatatgaataaa
aactttgcggaaggacaggcaatggatcttgtccacggcttaccgtttttgccgcaagtc
gatattcatgccggcgggcagaacgattacaccgacagcgatatcatcgtaataaccgcc
ggagcaaaacagcagccgggagaaacgagaatagacctccttaagcgtaatgccaccatc
attaaaaccattgccaaagaaatcgccgcaagcggctgtaaaggtgttatgctgcttgtc
agtaaccctgtcgatattcttaccaaggtagcgctcgaagcaagcggttgggatcgcgga
agggttatcggttccggcaccgtcttggataccgctcgtttccgctacgtactcagcaaa
gaatgcggcgtcgatgcccgtaatatacacggatacatcctcggcgagcacggcgacagc
gaatttgccgcatggtcgatgaccaccatagccggacggcgcatcgacgaatactgcggc
cacggagtttgtagttctggtattcacttcgataaagaaaaaatcttagacgaagtacgc
cattccgcctatcatatcatcgactacaaaggttcaacctattttgccgtcggtctagca
cttaccagaattgccggcgccattctgcgaaatgagcgcagtattctttccgtttctaca
gccttgaacggcgagttcggtctgcatgacgcctgcttaagcgttccctgtattgtcggc
agaaacggtgttgacagaattatcgaaggcgaactacccgcggatgaacagtctgcgctc
gaatcaagcgctcgccgactttacgatgcatacctttccatttgctaa

DBGET integrated database retrieval system