KEGG   Treponema sp. OMZ 804: GWP43_01820
Entry
GWP43_01820       CDS       T06435                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00071  Fatty acid degradation
trz00625  Chloroalkane and chloroalkene degradation
trz00626  Naphthalene degradation
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_01820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GWP43_01820
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GWP43_01820
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GWP43_01820
   00626 Naphthalene degradation
    GWP43_01820
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GWP43_01820
SSDB
Motif
Pfam: Fe-ADH ACT_7 Fe-ADH_2
Other DBs
NCBI-ProteinID: QHX42392
UniProt: A0A6P1Y0D4
LinkDB
Position
complement(394020..395168)
AA seq 382 aa
MSNFTFKLTSNIILGSYSIAKIGAEAVQFGKKFLFIVDPLLHETGIAKKVIDALEERGIS
VLVFDGVKRSADSDIIENALGLARGVFIDAVIASGGMGPVAIGRAVASLYNESGSIYDFI
EGKPCTAEPLPFIEVPATCREPFTFTPFSPIVDVRSRKIHLLKVRNDLCKLCVFDTACYS
NLAPNATVATILQGVGIAFEGYISSKTNFLSETILGKAIDRFLLSLDPQYGRATGASRET
VIAEAACLTAIGISFSSPGLGSAIALACASRYNISSSVVGTILLPYVLTNAQTSSLDRLV
KIGRMLNVDTRGVDPLYVAKSAIEEIRRRLAQANLPTRLKDIGLSIEQLVAISEDAVSLS
FMNYIPKPMRSDDVFELLKQAY
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtctaattttacctttaagcttacatcaaatattatcctcggaagctactccatagca
aaaataggtgcggaagccgttcagttcggaaaaaaattcttatttattgttgatccgttg
ctgcacgaaaccggtattgctaaaaaagttattgatgcactggaagaaaggggtatatcc
gttcttgtattcgacggtgtaaaacgttccgccgactccgatatcattgaaaacgcatta
ggccttgcacgcggagtttttatcgatgccgtcattgcatccggcggtatgggacccgtt
gctattggtcgtgctgttgcctcgctgtacaatgagtccggctcaatctatgactttatc
gaaggaaaaccctgtacagcagagccgcttcctttcatcgaagtcccggctacttgtagg
gaaccgttcacttttacgccgttcagcccgattgtcgatgtacgatcccgaaaaattcat
ttgctaaaagtacgcaatgacctttgtaaactctgcgtctttgataccgcctgttattca
aaccttgcgccgaatgcaaccgtagcaaccattcttcaaggagtcggtattgcatttgaa
ggatatatttcctcaaaaacaaactttttgtcggaaacgattttagggaaagctattgac
cgcttcttattgtcgcttgatccgcagtacggacgggctaccggtgcttcccgcgaaacg
gttattgcagaagcagcctgtttaaccgccataggcatttctttttccagccccggatta
ggtagcgccattgcccttgcatgtgcaagccgctataatatttccagttcggtagtcgga
acaatccttttgccgtatgtcctcacaaatgcacaaacatcgagcctcgataggctcgta
aaaatcgggcggatgctgaatgtcgatacacgcggtgtcgatccgctttatgtagcaaag
tctgctatcgaagaaatccgtcgtcgtttggctcaagcaaatctacctacccgcttaaaa
gatatcggtttatccattgagcagctggttgctatttccgaagatgccgtttcgctgagt
tttatgaattatatccccaaaccgatgcggagcgacgatgtgtttgagctacttaaacaa
gcatattag

DBGET integrated database retrieval system