KEGG   Treponema sp. OMZ 804: GWP43_02080
Entry
GWP43_02080       CDS       T06435                                 

Definition
(GenBank) alpha-amylase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_02080
Enzymes [BR:trz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     GWP43_02080
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     GWP43_02080
    3.2.1.135  neopullulanase
     GWP43_02080
SSDB
Motif
Pfam: Alpha-amylase DUF5696 Aminotran_5
Other DBs
NCBI-ProteinID: QHX42435
UniProt: A0A6P1XYM7
LinkDB
Position
complement(448587..449963)
AA seq 458 aa
MAQVFSDKVFYHIYALGMGNCPKRNDFACPAGDIFEKLAGRLDEVRALGCNALLIGPVFE
STAHGYDTVDYYHVERRLGNNERFKEFCRLCHEKGFAVVLDAVFNHTGRNFFAFKDIQRH
GYGSAYKDWYVNLDFSRRSAQGDCFEYEGWAGCKDLVKLNGDSGAVREHLFGAVKMWIEE
FGIDGLRLDAADVLSKNFLDALGAFCRSIKPDFWLMGEVVHGDYAEWARNNRLDSVTNYQ
IYKALWSCLNDQNMYELSYNLDKEYNSERGMYRDSALYNFVDNHDVNRAVSALNKPEQHI
HLLYGLLFTIPGIPSIYYGSEYGIRGVRSHNCDYELRPPLPPFGELPDFTAPGFDAGFIR
TSITTFAKIRRQHPALQRGSYRQEFVANRQFGFWREYREYNEEKILIIVNADFAQSFVSL
HTIPAGEYESLTDGRVYHSDALKGLQMPPCSILILRRK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggctcaagttttttcagataaggttttttatcatatttatgcgctggggatggggaat
tgtcctaagcggaatgactttgcgtgtccggcgggggatatttttgagaaactggcgggg
cggttggatgaggttcgggcgttggggtgtaatgcgctgctgattgggccggtgtttgag
tcaacggcgcatgggtatgatacggtggattattatcatgtggagcgccggttggggaat
aatgagcggtttaaggagttttgccgtctgtgccatgagaagggctttgcggtggtgctg
gatgcggtgtttaatcatacggggcggaatttttttgcgtttaaggatattcagcggcat
ggatacggcagcgcctataaggattggtatgtcaatcttgatttttcccggcggagtgcg
cagggggattgctttgagtatgaaggctgggccggctgcaaggatttggtcaagctgaat
ggcgatagcggcgcagtgcgggagcatctctttggtgcagtaaaaatgtggattgaagag
tttgggatagacggactcaggcttgatgcggcggatgtgttaagcaaaaacttccttgat
gcgttgggggctttttgccgaagtattaagcctgatttttggctgatgggtgaggtggtg
catggcgactatgccgaatgggcgcggaacaacaggcttgattcggtaacaaattatcaa
atttacaaagcgctctggtcgtgtttgaatgatcagaatatgtatgagctttcgtataat
ttggacaaggaatacaatagcgaaagaggaatgtacagggacagtgcattgtataatttt
gtggataaccacgatgtaaaccgcgcggttagtgcgctcaacaagccggagcagcatatc
catcttttgtacggactgctttttaccattcccggtattccgtctatttattacggcagt
gagtacggcatcagaggggttcggagccataattgcgattatgaactgcgtccgccgctc
ccgccgttcggtgagcttccggattttaccgctcccggttttgatgcaggatttatccgc
acctcgattacaacatttgcaaagatacgcagacagcatcccgccttacagcgcggttcg
taccggcaggagtttgttgcaaaccggcaattcggcttttggcgcgaatatcgcgaatat
aatgaagaaaaaatattgattatcgtgaatgcggattttgctcaaagctttgtttcgctg
cataccatcccggcaggtgagtatgagagcttgacggatgggcgcgtctatcattccgat
gcgttaaaagggctgcaaatgcctccgtgttcgatactgatattgcggaggaagtga

KEGG   Treponema sp. OMZ 804: GWP43_05635
Entry
GWP43_05635       CDS       T06435                                 

Definition
(GenBank) glycoside hydrolase family 13 protein
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_05635
Enzymes [BR:trz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     GWP43_05635
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     GWP43_05635
    3.2.1.135  neopullulanase
     GWP43_05635
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_N GHL10 DUF3459
Other DBs
NCBI-ProteinID: QHX43012
UniProt: A0A6P1Y267
LinkDB
Position
1201703..1203610
AA seq 635 aa
MQFSAIEHRSTDNFCYPLNENELMIGIKTGSDIRRVFIVYGDPFDGSVTPDGWAWEGKRQ
EITRKKDLPYHTWWQATVMLPYGRCKYCFELHGQDEGDVRYCLENGFYTADELVTLRRIT
GNFPGFEFPWLDGAECVRVPDWVPRTVWYQIFPDRFCRDTSSQKPNDLPWPAAKDVVTNN
EHYGGTLRGITEKLGYLADLNITGLYLNPVNASPSVHKYDTSDYLNIDPAFGSADDLHTL
VKEAHARGIKVMLDGVFNHCGWDFALWQDVVRNGKVSPYFDWFIVQEWPFETVVEPECEA
VASRSRPSGTNGKSGKYSTFAYVDTMPKLNTNNPAVVDYLLNVCETWVRSYDIDGLRLDV
ANELSHTFCRQLYRRMRSLKKDFYLLGEIWRSALPWLRGGELDSVMNYPLALCFWKFFYD
KTLPALTLEREINAVFTAYPEPVTVGLFNLLDSHDTPRLFTRNGGDAFAVWQQYALLLSL
PGSPCIYYGSEVLLAGGNDPDCRRCMPWQAIEAGEYAEPMSMMRQLIALRHTHPAMTASG
YSYLHDVPLAESEPNRIIHLQKYAETVEPAETTETVETAEVPITRSIDLILNCGTAPVSI
AQIIDEKARVYLSLRCRDKTVQPGGFIFFEHLINR
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgcagttttctgcaatagaacatcgcagtacggataatttttgttatccgctcaatgaa
aatgaacttatgatcggcattaaaaccggcagcgacatacggcgtgtatttattgtatac
ggagatccgttcgacggttcggtaacaccggacggatgggcatgggaaggcaaacggcag
gaaatcacccgcaaaaaagatcttccgtatcatacatggtggcaagcaacggttatgctt
ccttatggacggtgtaaatactgctttgaactgcacggtcaagatgaaggcgatgtccgc
tactgtctggaaaacgggttttacacggcagatgagcttgttacgctgcgccggataacc
ggtaattttcccggttttgagtttccgtggctggacggcgccgaatgcgtccgcgtaccg
gattgggtaccccgcacagtgtggtatcaaatttttcccgatcggttttgcagggatacc
tcctcgcagaaaccgaatgatctgccgtggcctgctgccaaggatgtcgttaccaacaat
gaacactatggcggtacgcttcggggtataaccgaaaagctcggttatcttgccgatttg
aatattaccggcttatatcttaatccggttaatgcttcaccgagtgtgcataagtatgat
acatccgattatctgaatatcgatcctgcattcggcagcgcagatgatctgcatacgctg
gtgaaagaagctcatgcgcgcggtataaaagtgatgctggacggcgtctttaaccactgc
ggctgggactttgcactgtggcaggatgttgtccgcaacggaaaagtctcgccgtatttc
gattggtttatcgtacaagaatggccgtttgaaaccgttgtagaaccggaatgtgaagcc
gtcgcgagccgaagccgaccgtccggtacaaacggaaagagcggaaagtacagtacgttt
gcgtatgtcgatacgatgccgaagctgaataccaataatcctgccgtcgtcgattacctg
ctgaacgtatgcgaaacatgggtgcgcagttatgatattgacgggctccggctcgatgtt
gcgaatgagctttcgcacacattttgcaggcagctttatcggcggatgcgcagtcttaaa
aaagacttttacctgcttggagaaatatggcgcagtgccttgccgtggctgcgcggcggc
gagttggattcggtaatgaattatccgctcgcgctgtgtttctggaaattcttttacgat
aaaacgctgcccgccctgactttggagcgggaaataaatgccgtttttaccgcctatccc
gaacctgttaccgtaggcctgtttaatctgctggattcccatgatacgccgcgccttttt
acccgcaatggcggtgatgcgttcgccgtatggcagcaatacgccctgttgttgagcctg
cccggttcgccgtgtatctattacggcagcgaggttttgcttgcaggcggaaatgatccc
gattgccgccgttgtatgccgtggcaggctatcgaagcaggtgaatacgccgaaccgatg
agcatgatgcggcagttgattgctttgcgccatacgcatccggcaatgaccgcttccggt
tactcatatctgcatgacgtaccgcttgccgaaagcgaaccgaatagaattattcatttg
caaaagtatgccgaaacggtagaacctgcggaaactacggagaccgttgaaaccgcggaa
gtgccgattacgcggagcatagacctcattctcaattgcggtacggctccggtatcaatc
gcgcagataatagatgaaaaggcacgggtatacctctccttgcgctgcagggataaaacg
gtacagcccggcggctttatcttttttgaacacctcatcaaccgatga

DBGET integrated database retrieval system