KEGG   Treponema sp. OMZ 804: GWP43_02210
Entry
GWP43_02210       CDS       T06435                                 

Definition
(GenBank) glycogen/starch/alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_02210
Enzymes [BR:trz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     GWP43_02210
SSDB
Motif
Pfam: Phosphorylase
Other DBs
NCBI-ProteinID: QHX42457
UniProt: A0A6P1XYD5
LinkDB
Position
complement(475879..478329)
AA seq 816 aa
MSQLKETLRASILGKLKRNFSKDISEATKRELYDAAASSVMDSIQPNISATRAAQEQPDV
RQMYYFSAEFLMGRALSNNLNNTGMRAVMEELLTELSASYRDIEDEEPDAGLGNGGLGRL
AACFLDSLATLDYPGHGYGIRYQYGMFEQRIENGYQMEYPDNWRRYRDPWEIRRDDLAVT
VRFGGTPICTQQEDSTLCYRLENAEEVIATPYDMAIIGYGTKTVNRLRLWEASSPNGFDL
QLFNNMEYTAAVAKQNSAENISRVLYPNDSGPSGKALRLKQQYFFTSASLQDLVRSFIHK
HGTNFSDFPRYNVIQLNDTHPVVAIPELMRLLMDEHHLGWDAAWAIVTQTFAYTNHTILA
EALEKWPIEIFQGLLPRVYQIVEEINRRFLLELREKYPNDWKKHNKMSIIGEGKIRMAWL
AIAGSFSVNGVAALHTEILKTKELSDWYNLYPQKFNNKTNGVTQRRWLLTANPALSAFIT
KHIGDGWIKDLTQLRQLEKLADNQEALQELIAIKKHNKERLAEFLKQTQGVVIDPNSIFD
VQIKRLHEYKRQLLNILHVMTLYNRIIEDPTYDPIPHTFIFGAKAASGYRRAKLIIKLIN
TVADRINNDHRVRGKLKVVFAANYCVSTAEKIFPASDISEQISTAGKEASGTGNMKFMLN
GAITLGTLDGANIEIVEEVGAENAVIFGITADEIQKIEHEHSYNPQEYLNRNPALARALT
QLIDGTYTPPFDNSFRELYDSLVYGVEGQRPDVYYVLADFDAYTAAQERIVEYYRNQMKW
AKMCLLNIARSGKFSSDRTIEDYVRDIWKLEKVSVN
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtctcaattaaaagaaaccttacgggcaagtattcttggcaagttgaaacggaatttc
agcaaggacatatccgaggcaacaaagcgtgagctctatgatgccgcagcaagcagcgtt
atggatagcatccagccgaacatatccgcaaccagagccgcgcaggagcaacctgatgta
cggcagatgtattatttctccgccgaatttctgatggggcgggcgctttcgaataatctg
aataacaccggtatgcgcgccgtaatggaagaacttttaacggagctttccgcctcgtat
cgggatattgaagatgaagaacccgatgcagggcttggaaacggcggtctcggtaggctc
gccgcctgttttttggactcgcttgcaacgctcgattaccccggacacggctacggtatc
cgctaccagtacggtatgtttgaacagcggattgaaaacggctatcagatggaatacccc
gacaattggcggcgttatcgtgatccgtgggaaatacgccgcgacgatttggcggtaacg
gtgcgcttcggcggcaccccgatatgcacgcagcaagaagacagcaccctgtgctatcgg
ttggaaaatgccgaggaggttatcgcaaccccctacgatatggcgatcatcggatacggc
accaaaaccgtcaaccgcctgcgcctgtgggaagcctcctctcccaatggattcgattta
cagctctttaacaatatggaatacaccgctgcggttgcaaagcagaactccgcagaaaat
atttcgcgcgtattataccccaacgacagcggcccgtcgggaaaagcgctccgcttaaag
cagcagtattttttcacttctgcaagtttacaggatttagtgcgttcatttatccataaa
cacggtacaaatttttccgacttcccgcgttataatgttatccagctaaacgatacgcac
cccgtcgtggcaatccccgaactgatgcgccttttgatggacgaacaccacctcggctgg
gatgcggcatgggcgattgttacgcaaacctttgcatacacaaaccatacgattttagcg
gaagctttggaaaaatggccgatcgagatattccaaggcttactgccgcgcgtgtatcaa
attgtagaagagataaaccgccgcttcctgctggaactgcgggaaaaatacccgaatgat
tggaaaaaacacaacaagatgtccattatcggcgaagggaaaatccgtatggcatggctc
gcaattgccggttccttttcggtcaacggtgttgcggcgctgcacaccgaaatccttaaa
accaaagagctgtccgattggtataatctgtatccgcagaaatttaacaataagacaaac
ggcgttacgcagcgccgctggcttttaactgcgaaccccgcgctttcggcctttatcacg
aaacatatcggcgacggctggattaaagaccttacccagctgcggcagcttgaaaaactg
gctgataatcaggaagcactacaggaattaatcgcgataaaaaaacacaataaagagcgg
cttgcggaattcctcaagcagacacagggtgttgtgatcgatccgaactcgatttttgac
gtgcagataaaacggctccacgaatacaagcgacagctcttaaacatcctgcatgtgatg
acgctctataacagaattatcgaagacccgacgtatgatcctatcccgcacacctttatc
ttcggcgcaaaagcggcgtcgggctatcggcgggcaaagctcatcattaagttgattaat
actgtcgccgaccgcattaacaatgatcaccgtgtacggggaaaattaaaggttgtgttt
gcggcaaactattgcgtctcgactgccgaaaagattttccccgcctcggatatttccgaa
cagatttccactgcgggtaaggaagcatcgggaaccggcaacatgaagtttatgctgaac
ggtgcaatcacgctcggaacactggacggcgccaatatcgaaattgtggaagaagtaggt
gctgaaaacgccgttatttttggtatcaccgccgatgagattcaaaaaatcgagcacgag
cacagctataatccgcaagaatacctgaaccgcaatcctgcattggcgagagcgctgacc
cagcttatcgacgggacgtatacgccgccctttgacaacagctttagagaattgtatgat
tcgctggtatacggcgtggaaggtcagcggccggacgtctattacgtactggcggacttc
gatgcatacacagcagcgcaggagcgaattgtcgaatactatcgcaaccagatgaaatgg
gctaaaatgtgccttctgaacatcgcccgatcgggtaagttcagttcagaccgtaccatc
gaagactatgtgcgggatatctggaagctggaaaaagtgagtgtcaattaa

KEGG   Treponema sp. OMZ 804: GWP43_05625
Entry
GWP43_05625       CDS       T06435                                 

Definition
(GenBank) pullulanase
  KO
K01200  pullulanase [EC:3.2.1.41]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_05625
Enzymes [BR:trz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     GWP43_05625
SSDB
Motif
Pfam: Alpha-amylase CBM_48 SpuA_C
Other DBs
NCBI-ProteinID: QHX43010
UniProt: A0A6P1Y174
LinkDB
Position
1198135..1200192
AA seq 685 aa
MRSPVKALEQTIPPRDTQLGAVYDAAAQSCRFSLWAPTSRDVSVNLYQNAGDSTPAFTVP
LQYDDATGLWCGIFAERDPEQFFYDYTLTNEAGTHTVLDPYSLSMAACTGSDGIGRGAII
NLQKETLKPEREYPYIALQKREDAIIYEVSVRDFTASPDSGVRNIPGTYKAFIEKIPYLR
ELGITHIQLMPVLNFYYTDETNQQYEDAGTVHNNNYNWGYDPHNYFTPEGWYASEPENPE
SRVRELRELINECHRAGLGVVLDVVYNHIARTDLFDMIVPGYYFRTNPDGSYTNGSCCGN
DIASERLMARKLIVDSAVHWVKNYKIDGLRFDLMGLLDTETVLEAYNRCRELNPSVLFIG
EGWKLYNGAEGTVGMDQRYMTETDSVAVFNDEFRDLVKAGGVNEEGKGFLTGGNVDLRQL
FCDCIGLPQCNYTADSPGDNVQYLVCHDGLTLHDCIAHNAGLDERIPVQRQELIARIKLG
NALALTCQGIAFLHAGQERGRTKPNVHGAAEECIGAFVRNSYDASDSVNRIVWTLDEDYA
ELLAYTRGLIALRKRFDVFRIGDAGRIAQAAAFLPAEDAAVAASGNCSGNRCAVKSVSGA
LSETEQQYGQAFGYTLDWTDGTWFLLFNAAGTEQCFVLGGTLQKPVVFVDGAAASPDGIA
QLSGIRFEQKRIILDPYTAAIVRSE
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgagatcacccgtcaaagctcttgaacagacaattccgcctcgcgatacccagctcggc
gccgtgtatgatgccgccgctcaaagctgccgtttttctttatgggcgccgacttcccgc
gatgtgtcggtaaacctctatcaaaacgccggtgattcaacgcctgcttttacggttccg
cttcagtatgacgatgcaaccggcctgtggtgcggcatctttgcggagcgggatccggaa
cagttcttttatgattacacgctgacaaatgaagcgggaacgcatactgtgcttgatccg
tacagcctctcgatggctgcttgtaccggcagcgacggtatcggacggggcgctattatc
aacctgcaaaaagaaacactcaaaccggagcgggaatatccgtatatcgccttgcaaaaa
cgggaggatgcgattatttacgaagtgtccgtccgcgattttaccgcaagccccgactcc
ggcgttagaaatatccccggcacgtataaagcctttatcgaaaaaattccctacttacgc
gaactgggcattacgcatattcagctgatgccggtgctgaacttttactacacggacgag
acaaaccagcagtatgaagatgccggtacggtacataacaacaactacaactggggctac
gacccgcataactattttacgcccgaaggctggtatgcaagcgagcctgaaaatcccgaa
agccgtgtacgcgaattgcgggagctgatcaacgagtgccatcgggcagggctcggtgta
gtgctcgacgtggtgtataatcatattgcgcgtaccgatcttttcgacatgattgttcca
ggctattactttcggacaaatcccgacggcagctataccaacggctcgtgctgcgggaac
gatattgcttcggagcggctgatggcacgaaagcttattgtcgattcggctgtacactgg
gtgaaaaactataagattgacggtctccggtttgatctgatgggactgctcgataccgag
acggtgctggaggcgtacaatcgctgcagagagcttaatccgtccgtactgttcatcggg
gaaggctggaagctgtataacggagccgaaggtaccgtcggtatggatcagcggtacatg
accgaaaccgacagcgttgccgtctttaacgatgaatttcgcgatttggtgaaagcaggc
ggtgtgaatgaggaaggcaaaggctttttaaccggcggcaacgtcgatcttagacagctc
ttttgcgactgtatcggtttgcctcagtgtaattacaccgccgacagcccgggtgataac
gtgcagtaccttgtttgccacgacgggcttacgctgcacgactgcatcgcccataatgcc
gggcttgatgaacgtattcctgtacaacggcaggagctgattgcccgtatcaaactcggc
aacgcgctggcgcttacctgtcaagggatcgcattcttacacgccggacaggagcggggg
cgtaccaagccgaatgtgcacggagcggcggaagaatgtatcggcgcttttgtgcggaac
agctatgacgcttcggacagcgttaaccgcattgtatggacgctcgatgaggattacgcc
gagctgctcgcatacacgcgcgggcttatcgcgttgcggaaacggtttgacgtgtttaga
ataggagacgccggacgcattgcacaagccgccgcatttttgcccgcagaagatgcagcg
gttgctgcatcggggaattgcagcggtaaccgatgtgccgtaaaaagcgtcagcggagca
ttgtccgaaacggagcagcagtacgggcaggcattcgggtacacactcgactggacggat
ggcacgtggtttttgttgtttaatgcggcgggaacggaacaatgctttgtgcttggcggc
acattacaaaagcctgtggtttttgtcgatggagcggcggcatcgccggacggcattgca
cagctctccggtatacgatttgagcaaaaacggatcatactagatccgtacactgcggct
attgttcgcagtgaatag

KEGG   Treponema sp. OMZ 804: GWP43_13105
Entry
GWP43_13105       CDS       T06435                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_13105
Enzymes [BR:trz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GWP43_13105
SSDB
Motif
Pfam: Glyco_hydro_77
Other DBs
NCBI-ProteinID: QHX44234
UniProt: A0A6P1Y3X4
LinkDB
Position
complement(2744723..2746783)
AA seq 686 aa
MKCSPLNQALCGAAVPVSALYSQKSCGVGEFSDLIPFADFCKKVGLRIIQLLPVNDTGTD
SSPYNALSAFALHPLYICLDDIPEAHSFKAEIKKICTAFRPHTPAEHFRYRDILHEKNVL
LHAVFNKAESQIIADSQTGELAEWIKANPWIIEYAVFKNIKRQNYHASWKDWKECADMRS
PSTAKITAAWNDSVLKREHLFYAWVQMHLHKQLLKAIAYCADNGISVKGDIPILMNEDSV
EVWAHPEYFRGDLRAGSPPDGDNPTGQNWGFPIYNWVNLKVTGYRWWKERLAHASQYYHA
YRLDHILGFFRIWAIPEGETTGLLGKPIPYAEITMKDLRKAGFSQERIRWMAEPHINTDI
VQTAVNGDYLYAHGLLYKVADRVGTEELWLFKDEIQSEVDIRRCGLPPEVETALRQKWTD
RMLVKAGKDLRGTVVYTAAYLYRNTTAWGTLSEDEQRRFSLLVEEKETEQNKLWAVQAED
ILSELCASVDMQPCAEDLGSKPAALPEILGKLHILSLRVFRWEREWKKDGAPFIPLCDYP
QEAVAVTSVHDSSTLREWWEEELSYADMLSFFNALRIDGNIRRALCPIDGKKPTYTADLA
AALLSALVKVPSVFAIFPIQDWLGLMIDEIHTVKPQDERINIPGTVSDSNWTYRLSFPIE
TLSKDKELIKRLRSITALRNPPKKNL
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaaatgttcaccgcttaatcaggctttatgcggggctgccgtaccggtttccgctttg
tacagtcaaaaaagttgcggcgtcggcgaattttccgacctcattccttttgcagacttt
tgcaaaaaagtaggactgcgcattattcaacttttacccgtcaatgatacaggcaccgac
agttccccatataatgctctttcggcttttgcattgcatccgctctacatctgcttggat
gatataccggaagcacatagcttcaaggctgagattaaaaaaatatgcactgcctttaga
ccgcacactccggcggagcattttcggtaccgggatatacttcacgaaaaaaatgtactg
ctgcatgctgtatttaataaggctgaatcacagattattgcggattctcagaccggtgag
cttgcggaatggataaaggcaaatccgtggataatcgaatatgcagtgtttaaaaatatc
aagaggcaaaactatcacgcttcgtggaaggactggaaagaatgtgccgatatgcgttct
ccttcaacggcgaaaatcactgctgcatggaacgattctgtcttgaaacgagaacatctg
ttctatgcgtgggtacaaatgcatctgcataaacaattgttaaaagccattgcctattgt
gccgataacgggatttcggtaaaaggcgatattccgattttgatgaacgaagattccgta
gaggtgtgggcacatcccgaatatttccgcggtgatctccgtgcgggcagtcctcctgat
ggggataatcctacgggacaaaattgggggttccccatttataactgggtaaatttgaaa
gtaaccggctaccgttggtggaaggaacggctcgcccatgcatcgcagtattatcatgcg
taccggcttgatcatatcttaggtttttttagaatttgggctattcccgaaggggaaaca
acagggcttttgggaaaacccatcccttatgcggaaattacaatgaaagatttaagaaaa
gcaggtttttcccaagaacgtattcgatggatggcagagccgcatatcaataccgatatc
gttcaaactgcggtgaacggcgactatttgtatgcgcatgggttattgtataaagttgcc
gatagagtcggtacggaagagctctggctttttaaagatgaaatacaaagcgaagtggat
atacgtcgttgcgggctgccgccggaagtagaaacagctttgcggcaaaaatggactgac
cgtatgcttgtaaaagccggaaaagacttacggggaacagttgtgtatactgcggcatat
ctataccggaatacaaccgcatggggaacgctatcggaggacgaacaaagacgattttca
ttgttggtcgaagagaaagaaacagagcaaaacaaactgtgggcagtgcaggcagaagat
attttgtcggaattatgtgcttccgtcgatatgcagccatgcgccgaagatttgggctcg
aaacctgcggcattgccggaaattctgggaaaattacatattttgagcctgcgggtattc
cgctgggaacgtgaatggaaaaaggacggtgctccttttattccgctgtgcgactatcct
caagaagcggttgcggtaacttccgtgcatgattcttcgacactgcgggaatggtgggag
gaagaattgtcttatgcagatatgctttcgttctttaatgctctgcgtattgatggtaat
atacggagagccctgtgtcctatcgacgggaaaaagccgacctatacggcggacttagct
gcagccttattgagcgctttagtcaaagttccgtcggttttcgctatctttcccatacaa
gattggttgggactcatgattgatgaaatacatacggtcaagccgcaggatgagcggatt
aacatccccggtacggtcagtgattcgaactggacataccgactgtcgtttccgatagaa
actttaagcaaggataaagaattgataaaacgattgcggagtataacggcattacggaat
ccgccgaagaaaaacctctaa

DBGET integrated database retrieval system