KEGG   Treponema sp. OMZ 804: GWP43_02215
Entry
GWP43_02215       CDS       T06435                                 

Gene name
glgX
Definition
(GenBank) glycogen debranching protein GlgX
  KO
K01214  isoamylase [EC:3.2.1.68]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_02215 (glgX)
Enzymes [BR:trz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     GWP43_02215 (glgX)
SSDB
Motif
Pfam: Alpha-amylase CBM_48 hDGE_amylase
Other DBs
NCBI-ProteinID: QHX42458
UniProt: A0A6P1XY80
LinkDB
Position
complement(478341..480485)
AA seq 714 aa
MENLSFLPGSPLPAGAAVYCDGVNFSVFSRHAFSVTLDIFAKSEDSAPCCSYTFDPQTNK
TGDIWHVFVKGLPKNALYLYRVDGPFAPYEGMRFNAGNYLLDPYSQGLANTESFSGNFST
QTPPPHIDGDLAFLTKQSPAHFPKCIAVAHDDFDWQGDHPLNYPLKDCIIYEAHVKGLSC
HPNAPQQHKGTYQGIIDTIPYLKELGITSLELLPIQEFNAHELTRINPRTGMVLKNYWGY
STIAFFAPKSSYASDREGIGAVFEFKRMVRELHKNGIEVILDIVFNHTAEGSEFEPTLSF
RGLDNTIYYILEDNARYYRNYSGCGNTFNCNHPIVQTFILDCLRYWVIEMHVDGFRFDLG
SILGRDQKGKLMDNPPTLEHIAEDPILRKTKIIAEAWDAGGAYQVGNFPGGRWAEWNDRF
RDDVRLFWRGDSSHARELATRVTGSADLYSGNGRKPFHSINFVTSHDGFTLYDLLSYDRK
HNEENGEDNRDGTDFNCSYNNGFEGKTENTRIETLRKQKAKNILLTLILSLGTPMLTAGD
EVLRTQRGNNNPYCQDNEISWFDWSLTQSNADILTFVKKLIRLRKQHPAFLRSEFLTGTQ
SGDRRKQDISWYDAQGNTPDWNQPSSFLAYFLDGSAAETRAECDDNSFYIILNGGSLDVT
ATICPPPQGKHWYRLIDTSYPAGEDFTDPEQAPLSENQQKYVVLAATAVVLILK
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggaaaacctatcatttttgccgggtagcccgcttccagccggtgctgctgtctattgc
gacggcgtaaatttcagtgtcttttcccgacatgctttttcggtaacgttggatatcttt
gcaaaatccgaagattccgcgccttgttgttcatacacttttgatcctcaaacgaataaa
acaggagatatctggcatgtctttgtaaaaggactgccgaaaaatgccttatatctttac
cgtgttgatggaccgtttgctccttatgaaggaatgcgctttaatgccggcaattatctg
ctcgacccatactcacaaggacttgccaacacagaatcttttagcggaaatttttctacg
caaacgcctccccctcatatagacggcgaccttgcttttttaaccaaacaatcgcctgct
cattttcccaagtgcatcgcagtagctcacgatgattttgactggcagggcgaccatccc
ctcaattatccgttgaaggactgcatcatctacgaagcgcatgtaaaagggctttcgtgc
catcccaatgcaccgcaacagcacaagggaacctatcagggtattatcgatactatcccg
tatttaaaagagctgggtattaccagccttgaactgctgcccattcaggaatttaacgcg
catgaattgactagaataaatcctcgaaccggcatggtgttaaaaaactactggggatac
agtaccatcgccttctttgcgcctaagtcgtcgtacgcttccgaccgtgaaggcataggt
gcggtattcgagttcaaacgaatggtgcgcgagctgcataaaaacggcatcgaagtgatt
cttgacatcgtatttaatcacacggcggagggcagcgaattcgagccgaccctttcgttc
cgcggcttggacaataccatctattatatattagaagataacgcccgctattaccggaat
tactccggctgcggcaacaccttcaactgcaatcatccgattgtgcagacctttatcttg
gactgcctgcgctactgggttatcgaaatgcatgttgacggcttccggttcgacctcggc
tccattttgggcagggatcaaaaagggaaactgatggataatccgcctacccttgagcat
attgccgaagatcccatattgagaaaaacaaagatcatcgcagaggcatgggatgcgggt
ggcgcctatcaggttgggaattttcccggcggcaggtgggcggaatggaatgaccgcttc
cgcgacgatgtgcgcctcttttggcgcggcgattcctcccatgctagggagcttgcaaca
cgtgtaaccggttccgccgatttgtactccggcaacggacgcaagcctttccattccatc
aactttgttaccagccacgatggatttaccctctacgatttattaagctatgatagaaaa
cacaacgaagagaacggagaggacaatcgggacggtaccgattttaattgcagctataac
aacggctttgaagggaaaaccgaaaacacccgcatcgaaaccctacggaagcaaaaagca
aaaaacatcctgctaacgctcattttatcgctgggaaccccgatgttgactgccggagat
gaggtactgcggacacaacggggaaacaacaacccctactgccaagacaacgagataagc
tggttcgattggtcgctgacacaaagcaatgccgacatactgacctttgtaaaaaaattg
atccgcctgcgcaaacagcatccggcgttcctgcgttcggaatttttaacgggaacgcaa
tccggagaccggcgtaagcaagatatcagctggtatgatgcacagggcaatacccccgat
tggaaccaaccttcatcgtttttagcgtattttcttgacggttccgcggcggaaacgaga
gccgaatgcgatgataacagcttttacatcatattaaacggcggtagtttagacgttact
gcaacgatatgccctcctccacaaggaaagcattggtatcggctgatcgatacatcctat
ccggcaggggaagattttaccgatcccgaacaggcgccgctgtcggaaaatcagcaaaaa
tatgttgtattagccgcgacagccgtcgtgttaattctgaaatag

DBGET integrated database retrieval system