KEGG   Treponema sp. OMZ 804: GWP43_02775
Entry
GWP43_02775       CDS       T06435                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00230  Purine metabolism
trz00620  Pyruvate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
trz01240  Biosynthesis of cofactors
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_02775 (pyk)
   00620 Pyruvate metabolism
    GWP43_02775 (pyk)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GWP43_02775 (pyk)
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     GWP43_02775 (pyk)
Membrane trafficking [BR:trz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GWP43_02775 (pyk)
Exosome [BR:trz04147]
 Exosomal proteins
  Proteins found in most exosomes
   GWP43_02775 (pyk)
SSDB
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI MuF_C
Other DBs
NCBI-ProteinID: QHX42547
UniProt: A0A6P1XYL4
LinkDB
Position
complement(593590..595350)
AA seq 586 aa
MKKTKIVCTIDPASDSEEILRELFKAGLNVCRLNFSHGTHEEHQIRIDRIKKIRQELNLP
IAIMLDTKGPEIRLKNFGVNSVQLSKGQQFTLTVRDVVGDEKICSVTYKNLAQEVQPNNR
ILIDDGLIELKVERIDNGTDIICTVMSDGPVSNHKGINIPGAKINLPFLSEQDISDLKFG
AQNEVDFVAASFTRGPADILSIRKVLEEANGNNIHIIAKIENQEGVDSIDKIIEVSDGIM
VARGDLGIEIPPEEIPLVQKMIIRKTLKASKPAITATQMLESMTHNPRPTRAEVTDVANA
IFDGTSAIMLSGETAAGKYPVETVKMMHRIAVTTENSLNYDKIMGAVAREHSLTITNAIA
HATCSMALEMNAQVIVTATSSGETPRALSKYKPKAPIVAVTPYEATARRLSLNWGVYPIV
TSYFKSTDEMFEQCINVAKENGFVQEGELAVLTAGVPIGLVGSTNLLKVETVGKILLKGK
GTGIQSVVTGRVKVIRSEQDLLTDFADGDIIVTQTTNDLMNSFIERAGAVITENGNLSGH
AALMGMNLSKPTIVGASEATSILKTGDIITLNGKTGVVIKGTAAIY
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgaaaaagacaaagattgtctgtactatcgatcccgcttccgactcggaagaaatactg
cgcgaattatttaaggcagggctcaacgtatgccgccttaatttttcgcacggtacgcat
gaagagcaccagatccgtatcgaccgtatcaaaaagattcgacaggaactcaacttgccg
attgcgattatgctggacaccaaggggccggaaatacggctgaaaaatttcggcgttaat
tccgtacagctgagcaagggacagcaatttacgcttaccgtacgcgatgttgtcggcgat
gaaaaaatatgcagcgtaacctataagaaccttgcgcaggaagtacagcctaataatcgc
atccttatagatgacggcttaatcgaactgaaggtcgagcggatcgataacggcaccgat
attatctgtaccgtcatgagcgacggccccgtatcgaatcataagggtatcaatattccc
ggagcaaaaatcaacctcccctttctgagcgaacaggatatttccgacttaaagttcggc
gctcaaaatgaggttgattttgtagcagcctcgtttacccgcggccctgcggatatctta
agcatccgcaaggtcttggaggaagcgaatgggaacaatatccatattattgcgaaaatc
gaaaaccaagaaggcgtcgactccatcgacaagattattgaagtttccgacggcatcatg
gttgctcgcggcgatttaggtatcgaaattccgccggaagaaattccgctcgtgcaaaag
atgattatccgcaaaacactgaaggcaagtaaaccggcaattacggcaacccagatgctc
gagtcgatgacgcataatccgcggccgacacgggcggaggttaccgatgttgcgaacgct
atctttgacggaacgagcgccattatgctttcgggagaaacggctgcgggcaaatatccg
gtagaaaccgttaagatgatgcaccgcattgccgttacaaccgaaaattcgttaaactac
gacaagattatgggggcggttgcccgggagcattctttgaccattacgaatgccatcgca
cacgcaacctgttctatggcgttggaaatgaatgcacaggttatcgttaccgcgacctct
tcgggagaaacgccgcgggcactttcaaaatacaagcccaaggcgccgattgttgccgta
accccctatgaagcaactgcacgccggttatcacttaactggggggtatatccgattgtc
acgtcctattttaaatcgacggacgaaatgtttgaacagtgcatcaacgtcgcaaaagag
aatgggtttgtacaagagggtgaactcgccgtgcttaccgccggagttcctatcggactg
gtcggttcgacaaacttgttgaaagttgaaaccgtcgggaagatcctgctgaagggtaag
ggcaccggcattcagtcggttgtaaccggccgagtaaaggttatccgttccgagcaagac
ttactgaccgactttgcggacggagacatcatcgtaacccaaacgaccaacgatttaatg
aattcctttatcgagcgggcaggcgctgtcattaccgaaaacggcaacttgagcggacac
gccgccttgatgggaatgaacttgtcgaagccgactatcgtaggcgcctccgaggcaaca
agcatattaaaaacaggcgatattatcacgctgaacggaaaaaccggcgtcgtgataaaa
ggaaccgccgctatttattaa

DBGET integrated database retrieval system