KEGG   Treponema sp. OMZ 804: GWP43_02790
Entry
GWP43_02790       CDS       T06435                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00030  Pentose phosphate pathway
trz00052  Galactose metabolism
trz00230  Purine metabolism
trz00500  Starch and sucrose metabolism
trz00520  Amino sugar and nucleotide sugar metabolism
trz00521  Streptomycin biosynthesis
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
Module
trz_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_02790
   00030 Pentose phosphate pathway
    GWP43_02790
   00052 Galactose metabolism
    GWP43_02790
   00500 Starch and sucrose metabolism
    GWP43_02790
   00520 Amino sugar and nucleotide sugar metabolism
    GWP43_02790
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GWP43_02790
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GWP43_02790
Enzymes [BR:trz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GWP43_02790
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_IV DUF2967
Other DBs
NCBI-ProteinID: QHX42550
UniProt: A0A6P1XZW8
LinkDB
Position
598291..600171
AA seq 626 aa
MNTAYPELQHAFEKMILSASGWRKVFAQSGSENDGAPEISAADRDIVFFAAQSFAEFLQA
EFPAIRTVIIARDSRPTGAALLKEAVTAFAAAGNTSAATSSAALAVQSVGIAAAPEIMAY
ARSAGAAFMYISASHNPIGHNGFKFGLDTGGVLDGSQSARLIALFTQKCAAAHQDTAAVL
RKQAAPAPVQAVFEAEAAHKQAALTAYQNFLQEVIADSKDSAEQARFFDDIRAQCTALAA
AGKPFTLVADFNGSARAASVDRAFFEKLGMQLVGIAEKAGNIVHGIVPEGGNLATCAAKI
EELHRSNPAQAENTLFGYMPDCDGDRGNIIYWDEAQQKALILEAQEVFALSVIAELSYLH
YSGNISAPLAVTVNGSTSLRINEIAKALDAEVFYAEVGEANVVNRAEDARRYGYKVRILG
EGSNGGNITYPAAVRDPLNTLFAISKLLLIKDMPDRSCPFRIWCERSGQTAKYRKDFTFA
DIIATLPRYWTTPTQEARALMHIHTTDHTALKSAYQKIFMQEWADKKQLLKDRFGIAACK
VFAYNGTVCTENLRDFGVSAKGGLKVQFYNASHTPIAFIWMRGSGTEPVFRIMADIKGYD
QAAEEYLVQWQGDMVRKADVAVSVKN
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgaatacagcataccctgaattacagcatgcatttgaaaagatgattctatcggcgtcg
ggctggcgcaaagtgttcgctcaatccggaagcgaaaacgacggagcgccggagatttcc
gctgccgaccgcgatatcgttttctttgccgctcaatcatttgcggaattcttacaagct
gagtttccggcaatccgcacggtaatcatagcccgcgacagccgccccaccggcgcagcg
cttttaaaagaggcggtaactgcgtttgcagccgctgggaatacttctgcggcaacaagc
tcggctgcactagcggtacaatcggttgggatagccgcggcgccggaaattatggcgtat
gcacgctccgcaggggctgctttcatgtatatttctgcaagtcataatcccatcgggcat
aacggctttaagttcgggttggataccggcggcgtactggacggaagtcaatccgcgcgg
ttgatagccttattcacacaaaaatgcgccgctgcccaccaagataccgcagctgtcctg
cgcaaacaggccgccccggcaccggtgcaagcggtgtttgaggcagaagcagcgcacaaa
caagcggcgcttaccgcctatcaaaactttttacaggaagtaattgccgattcaaaagac
agcgcggaacaagcacggttctttgatgacattcgcgctcaatgtaccgcgcttgcggca
gcaggtaagccgtttacgctggttgcagactttaacggcagcgcccgcgccgcttcggtt
gaccgagctttctttgaaaagctcggtatgcagcttgtcggtattgcggaaaaggccgga
aatatcgtccatggtattgttcccgaaggaggaaaccttgcaacctgtgcagccaaaatc
gaagaactgcaccggagcaatcccgcacaggcggagaatacgttgttcggctatatgccc
gattgcgacggggaccgcggcaatatcatctactgggatgaagcgcagcaaaaagcattg
atccttgaagcgcaggaagtctttgccctgtcggtcatcgcagaactgagttatctgcac
tacagcggtaacatcagcgcgccacttgcggttaccgtcaacggatcgacttcgctccgc
attaacgaaatcgcaaaagccttggatgcggaagtgttttatgcggaagtaggcgaagcc
aatgtagtaaaccgggcggaagatgcacgtcggtacggttataaagtgcggatactcggc
gaaggttccaacggggggaatattacgtaccctgccgccgtgcgtgacccgctgaatacg
ctctttgcaatcagcaagctcctgctcataaaggatatgcctgaccgctcctgcccgttc
cgtatctggtgcgagcggtcggggcaaacggcaaagtaccggaaagactttacctttgcg
gatattattgcaacgcttccccgctattggactaccccgacgcaggaagctcgggcgctg
atgcacatccatactaccgaccataccgcactgaaatcggcatatcagaagatttttatg
caggaatgggcggataaaaaacagctgctgaaagaccggttcggtatagcagcctgtaaa
gtatttgcgtataatgggacggtttgtacagaaaacctcagggattttggggtttccgca
aagggcggcctcaaggtgcagttctataatgcaagccatactccgattgcctttatctgg
atgcgcggttccggtaccgaaccggtattccgcattatggcggacatcaaaggatatgat
caggcagcggaagaatatctggtgcagtggcagggagatatggtacgcaaagccgatgtg
gcggtatcggtaaaaaattaa

KEGG   Treponema sp. OMZ 804: GWP43_07975
Entry
GWP43_07975       CDS       T06435                                 

Definition
(GenBank) phospho-sugar mutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00030  Pentose phosphate pathway
trz00052  Galactose metabolism
trz00230  Purine metabolism
trz00500  Starch and sucrose metabolism
trz00520  Amino sugar and nucleotide sugar metabolism
trz00521  Streptomycin biosynthesis
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
Module
trz_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_07975
   00030 Pentose phosphate pathway
    GWP43_07975
   00052 Galactose metabolism
    GWP43_07975
   00500 Starch and sucrose metabolism
    GWP43_07975
   00520 Amino sugar and nucleotide sugar metabolism
    GWP43_07975
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GWP43_07975
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GWP43_07975
Enzymes [BR:trz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GWP43_07975
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Other DBs
NCBI-ProteinID: QHX43392
UniProt: A0A6P1Y3A1
LinkDB
Position
complement(1705022..1706779)
AA seq 585 aa
MDSKTILTSAKQYIAEETDPTFVKEVEALIAKNDEKELFDRFYRQLEFGTGGLRGIIGGG
TNRMNPTVIKKATQGLADYIIETFPEKAKKGQLKAVIAHDSRRYSDVFAEATALIFAANG
FTVYLFSALRPTPELSYAIRHLGCDTGVVVTASHNPPQYNGYKAYWNDGAQVIPPHDKGI
IDKVNAVKKVNMMNRDEAIKSGKLIIIDKEIDEKYWASVKAKLHRGDLIKEMSKSVKIVY
TPLHGTGAMHVEKVLGDMGFNIITVPEQRQPDGNFPTVSYPNPEDPAALKMAIALAEKEG
ADILMATDPDADRFASAVKDGNRKMHLITGNQMGALFADYLCLTAKEFGVMPAKPAIVRS
IVTSHLCDRIAKSYGVASFECLTGFKWICNKADEISKQGYHYIYGFEESYGYNFGMEIRD
KDGIAASALCAEMSLYWRKQGKSLLDRLNELFTQHNLFCEKTINKVFPGAEGVEIMKNMM
IKLRTSALKDIAGVKVLTIRDIDQSCSYNPLTPDKKEAVHLPVSNVLQYYLEDGTIISIR
PSGTEPKIKFYIIHPQPVQGKDVAAAQTKAEQQVKIFAQALDTIV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggatagtaaaacaattctaacctctgcaaaacagtacatagcagaggaaaccgatcct
acatttgtaaaggaagtggaagcgctcatcgcaaagaatgatgaaaaagagctgtttgac
cgcttctaccgtcaattggaattcggtaccggcggtttgcgcgggattatcggtggcgga
acaaacaggatgaatcctacggttattaagaaggcaactcaagggcttgctgactatatt
atcgaaacctttcccgaaaaggcaaaaaaaggccaactaaaagcagttatcgcgcatgat
tcgcgccgctattcggatgtgtttgcagaggcaaccgcgctcatctttgcggcaaacggt
tttacggtgtacctgttttcggcattacgcccgacaccggagctttcctatgcaatccgc
cacctcggctgcgataccggtgtagtcgttaccgcttcgcacaatccgccgcagtataat
ggatacaaagcatattggaatgacggtgcacaagttatcccaccccacgataagggcatt
atcgacaaggtcaatgctgttaaaaaagttaacatgatgaaccgcgacgaagcgattaag
agcggtaaactcatcatcatcgataaagagatagatgaaaaatattgggcgagcgttaag
gccaagctgcatcgcggtgatcttattaaagagatgtcaaagtccgtaaaaattgtttac
accccgctgcacggtaccggtgcgatgcatgtcgaaaaagtactcggcgatatgggcttt
aacatcatcaccgtacccgaacaacgtcagccggacggcaatttcccgacagtcagctac
cccaatcccgaagaccctgctgcgcttaaaatggcgattgcacttgcggaaaaagaaggc
gccgatatcctgatggcaaccgaccccgatgccgaccgttttgcttcggcggtaaaagac
ggcaacagaaaaatgcatcttattaccggcaaccagatgggcgccctttttgccgactac
ctctgcctgactgcaaaagaattcggtgttatgccggcaaaacctgccattgttcgttct
attgtaacatcgcatctgtgtgaccgtattgcgaaaagctacggggttgcttcctttgaa
tgcttaacgggatttaagtggatctgcaacaaagctgatgaaatttccaaacaagggtat
cactacatttacggctttgaggaaagctacggctataatttcgggatggaaatccgcgat
aaagacggaattgctgcctctgctctctgtgccgagatgtcgctctattggcgtaaacaa
gggaagagcttgttagatcgcttaaacgaactctttacacagcataacctcttctgcgag
aaaaccatcaacaaggtgtttcccggtgcggaaggcgttgaaattatgaaaaatatgatg
ataaagctccgtacttccgcattaaaggatattgccggcgtaaaggttctaaccatccgc
gatatcgatcaatcatgttcatacaacccgttgacacctgataaaaaagaagcggtacat
cttccggtaagtaatgtgttgcagtattatcttgaagacggaacgattatcagtatccgc
ccgagcggtaccgagcccaagatcaagttttatatcatccatccgcagccggtacagggt
aaggatgttgccgccgctcagaccaaagcagaacagcaggttaaaatttttgctcaagcg
ttggacactatcgtctaa

DBGET integrated database retrieval system