KEGG   Treponema sp. OMZ 804: GWP43_03105
Entry
GWP43_03105       CDS       T06435                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00030  Pentose phosphate pathway
trz00051  Fructose and mannose metabolism
trz00052  Galactose metabolism
trz00680  Methane metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_03105
   00030 Pentose phosphate pathway
    GWP43_03105
   00051 Fructose and mannose metabolism
    GWP43_03105
   00052 Galactose metabolism
    GWP43_03105
  09102 Energy metabolism
   00680 Methane metabolism
    GWP43_03105
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GWP43_03105
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     GWP43_03105
SSDB
Motif
Pfam: PFK DUF956
Other DBs
NCBI-ProteinID: QHX42602
UniProt: A0A6P1Y0Z9
LinkDB
Position
complement(660120..661199)
AA seq 359 aa
MTAHKRLGILTSGGDAPGLNAAIRALARTAMNRYGMEVVGIEQGYRGLIENKYHILTEQD
LSGILARGGTILGASREKPFKDRGWRNADGSGAVDCIKKNYKDLRLDCLAVLGGNGSQTT
ADMLANEGLNIIGIPKTIDNDIVHNDMSFGFHTALDIATDAIDRLHTTAASHNRIMVIEI
MGHKAGWLALYAGIAGGSDVIIIPEIPYRIEAIAEHLLERRKKGKHFSVIAVAEGAVSFS
EKDMNKKALKEARKSMVGSIGYRVAGEIEAATGADARVTVLGYLQRGGTPSGYDRILATR
FGAAAAEFAAEERYGVMTALQQGGITAVPLSKVADKVKKVPEDHPMIRAAWDVGTCFAG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactgcacataaacgcctcggcattttaacatcggggggcgatgctcccggcttaaac
gccgctatcagagctttagctcggacagcgatgaaccgttacggaatggaagtggttggt
attgagcaagggtaccgcggcctcatcgaaaataagtatcatatattgacggagcaagat
ctttccggcatcctcgcgcgcggagggactattttgggggcttcccgtgaaaaaccgttt
aaagaccgcggttggcgtaatgcggacggcagcggggcggttgattgtattaaaaaaaat
tacaaagacttacgtttagactgtctcgccgtcctcggcggcaatggctcgcagactact
gccgatatgctcgcaaatgaaggactgaatatcatcggtattccgaaaaccatcgacaac
gatattgtgcataatgatatgagcttcggcttccacaccgcgcttgatattgcaacggat
gctattgaccggctgcatacgacggcggcgagtcataaccgtattatggtgatagaaatt
atgggacataaggcgggatggcttgcgctctacgcgggtattgccggcggcagcgatgtt
attatcatccccgaaatcccctaccggattgaagcaatagccgagcacttactggaacgc
cgtaaaaaaggaaaacatttttccgtaattgctgttgccgaaggtgccgtatcgtttagc
gaaaaggatatgaacaaaaaagccttaaaggaagcacgtaaatctatggtcggttcgatc
ggatatcgggtcgcaggggagatagaagcggctaccggtgccgatgcgcgggttacggtg
ctcggctatttgcagaggggcggtaccccctccggctatgaccgtatattggcaacgcgc
ttcggcgctgctgctgccgagttcgccgcagaggaacggtacggcgttatgacagctctg
caacaggggggaatcaccgccgtacccctcagtaaggtcgccgataaggtcaagaaagta
ccggaagaccacccgatgattcgcgccgcgtgggatgtcggcacctgctttgccggttaa

KEGG   Treponema sp. OMZ 804: GWP43_13875
Entry
GWP43_13875       CDS       T06435                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00030  Pentose phosphate pathway
trz00051  Fructose and mannose metabolism
trz00052  Galactose metabolism
trz00680  Methane metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
trz03018  RNA degradation
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_13875
   00030 Pentose phosphate pathway
    GWP43_13875
   00051 Fructose and mannose metabolism
    GWP43_13875
   00052 Galactose metabolism
    GWP43_13875
  09102 Energy metabolism
   00680 Methane metabolism
    GWP43_13875
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GWP43_13875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:trz01009]
    GWP43_13875
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:trz03019]
    GWP43_13875
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GWP43_13875
Protein phosphatases and associated proteins [BR:trz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GWP43_13875
Messenger RNA biogenesis [BR:trz03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GWP43_13875
SSDB
Motif
Pfam: PFK DAGK_cat
Other DBs
NCBI-ProteinID: QHX44369
UniProt: A0A6P1Y4P2
LinkDB
Position
2915520..2916887
AA seq 455 aa
MRYNEEFNFTIDTLCPCKIPSPIHLSNVIGDSIANYVTNDDFIRFRLESKVGEQYGTFKR
EQLIEKAGPREKIFFNPSHVHAGIITCGGLCPGLNDVIRSVVRCLWGRYGVKRISGIRFG
FKGLLPDYHFDVMPLNPTVVDACHKTGGTILGTSRGGGTRVVEIVDGIERLNLNILFVIG
GDGTQKGALEIAKEIERRDLCISVVGIPKTVDNDLSFIQKSFGFDTAVVKASEAVAAARM
EAQSQINGIGLVKLMGRESGFIATHTAIASHEVDFVLIPEIPFDMRGENGFLKHLEDRLA
QSHYTVIVVAEGAGQDLMQSKNETDDSGNKRLSDIGVFLKEQIDAYFKSKSIHINLKYID
PSYQIRSAPAAPVDSIYCERLGNNAVHAAMAGKTKLIVGLMYNKFVHLPINVVVRSRNYV
EPDGSLWRDTLDATGQPPLMKNKTHDDHNKHTSAH
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgcgctataatgaagaatttaattttaccattgatacactctgtccctgtaaaatacct
tctcctattcacctttcaaacgtaatcggcgacagtattgcaaattacgttaccaatgac
gattttattcgcttccggttggaatctaaggtcggagagcagtacgggacattcaaacgc
gaacagcttatcgagaaagcaggtccgcgggaaaaaatattctttaatccgagtcatgtc
catgcaggcattatcacatgtggaggattatgccccggccttaatgatgtgatccgatcg
gtcgtacgctgtttgtggggacgttacggcgttaagcgaatcagcggcattcgcttcgga
tttaaaggccttttaccggactaccatttcgatgttatgcccttaaacccgacggttgtc
gatgcatgtcataaaacaggaggaacaatcctcggcacttcacgaggcggaggtacccgc
gttgtcgaaatcgtagacggaatcgagcggctcaatttgaatatcctttttgtcatcgga
ggcgatggaacacaaaaaggcgctttagaaattgcaaaggaaattgaacgacgcgacctg
tgtatctccgttgtcggcatcccgaaaaccgttgataacgacctgtcgtttattcaaaag
tccttcggtttcgacacggcagttgtaaaagcctctgaagcagttgctgccgcccgtatg
gaagcacagtcccaaatcaacggtatcggattagtcaagctgatgggacgagaatcggga
tttattgcgacgcacacggctattgcaagccatgaggtcgactttgtacttatccccgaa
attcctttcgatatgcgaggtgaaaacggttttttaaagcatttggaagaccgcttagcc
caaagtcattacacagttattgttgttgcagaaggagccggtcaagacttaatgcaaagc
aaaaatgaaaccgacgattcaggcaataagcgtctttccgatattggcgtattcttaaaa
gagcaaatcgatgcttattttaagtcaaaatccattcatatcaacttgaagtatatcgat
ccgagctatcaaatccggtcagcgccggcagcgccggttgactctatttactgtgaacgg
cttgggaataatgcggtacatgccgctatggcgggaaagacaaagttgattgtcggtctt
atgtataataagtttgttcatttgccgatcaatgtcgtcgtccgttctcgcaactatgtc
gaaccggacggctcgctctggcgcgacaccctcgatgcgacaggtcagccgcctctaatg
aaaaacaagactcacgatgaccacaataaacatacatctgctcattag

DBGET integrated database retrieval system