KEGG   Treponema sp. OMZ 804: GWP43_03280
Entry
GWP43_03280       CDS       T06435                                 

Gene name
eno
Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00680  Methane metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
trz03018  RNA degradation
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_03280 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    GWP43_03280 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GWP43_03280 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:trz03019]
    GWP43_03280 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_03280 (eno)
Enzymes [BR:trz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     GWP43_03280 (eno)
Messenger RNA biogenesis [BR:trz03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GWP43_03280 (eno)
Exosome [BR:trz04147]
 Exosomal proteins
  Proteins found in most exosomes
   GWP43_03280 (eno)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-ProteinID: QHX42633
UniProt: A0A6P1Y074
LinkDB
Position
697875..699173
AA seq 432 aa
MSDIVYIEGREILDSRGNPTVEVDVALSDGSFGRACVPSGASTGEFEALEMRDGDAKRYG
GKGVLKAVDNVNTIIAEELEGMDALEQAEIDQTMLNLDGTPNKSKLGANAMLGVSMAVAR
AAADYVGLPLYRYLGGAHTLQMPVPMANIINGGKHSDNKIDFQEYMVMPIGAESIHEAVR
MTAEVFHALKGLLKADGKATSVGDEGGFAPDIDNEAALEYIMKAIDKAGYKPRTDIAIAL
DCASSELFDEGGRKGYKFWKSNPGKLFTADEMIEIYKKWINTYPIVSIEDPLDQNDWEGY
ARLTKELGSKIQIVGDDFFVTNTERLQRGIKEKACNSILIKLNQIGTVTETIDAVRMAQN
AGYTAVISHRSGETEDAFIADLAVAVEAGQIKTGSMSRSDRIAKYNQLMRIEEELGCQAR
YAGAATFARYGF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcgatattgtgtatattgaaggacgtgagattctcgattctcgcggaaatcctacg
gttgaagttgatgttgcattgagcgacggcagtttcggacgcgcctgtgttccgtccgga
gcgtctaccggcgagtttgaagcgttggagatgcgcgacggcgatgcaaaacgctacggc
ggcaagggtgtattaaaggctgtcgataacgtaaataccattattgcggaagagcttgag
ggaatggatgccttggaacaggctgaaatcgatcagactatgcttaatctggatgggaca
ccgaataagtcaaaactcggcgccaatgcgatgctcggcgtttcgatggcagtggctcgc
gccgccgccgactatgtcggtttaccgttgtaccgctacttgggcggtgcacataccttg
caaatgcccgtaccgatggcaaatatcatcaacggcggcaagcattccgacaacaaaatc
gactttcaggaatatatggtgatgccgatcggcgccgagtccattcacgaagcggtgcgc
atgacggcggaagttttccatgcgttaaaaggccttttaaaggcggacggtaaggcaacc
tccgtcggagatgaaggcggttttgccccggatatcgataacgaagcggcgctggaatat
attatgaaggcaatcgataaggcaggctacaagccacgcaccgatattgctatcgcgctc
gactgcgcttcttccgaattgttcgatgagggcggacgcaagggctataaattctggaag
tcaaatcctggcaagctgttcactgcggatgagatgatcgaaatctataaaaagtggatt
aatacctatccgattgtttctatcgaagatccgctcgatcaaaatgattgggaaggctat
gcacgtttaactaaagaacttggcagcaaaattcagattgtcggcgacgacttctttgtt
accaacaccgaacggttgcagcgcggtattaaagaaaaggcttgtaactctattctgatt
aagctcaatcagatcggtaccgttaccgaaaccatcgatgcggtacgaatggcgcagaat
gcaggctatactgcggttatctctcaccgttcaggcgaaaccgaggatgcgtttatagcc
gacctcgccgttgcagtagaagcgggacagatcaaaaccggttcgatgagccgcagtgac
cgtattgcaaagtacaaccagctgatgcgcattgaagaagaactcggctgccaagcccgc
tatgcaggcgccgcaaccttcgcacgctacggattttaa

DBGET integrated database retrieval system