KEGG   Treponema sp. OMZ 804: GWP43_03650
Entry
GWP43_03650       CDS       T06435                                 

Definition
(GenBank) glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz00520  Amino sugar and nucleotide sugar metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_03650
   00520 Amino sugar and nucleotide sugar metabolism
    GWP43_03650
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     GWP43_03650
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Other DBs
NCBI-ProteinID: QHX42690
UniProt: A0A6P1Y0B0
LinkDB
Position
complement(779233..780504)
AA seq 423 aa
MPKVLSIILGGGKGTRLYPLTQSRSKPAVPFGGKHRIVDIPISNCINSGLRQIYVLTQFN
SASLHLHIARAYRFDSFSNGFVEILAAEQTFEHSGWYEGTADAVRKNFTHFKTQDPKYYI
ILSGDQLYRMNLQDFLAQHEASGADITIACTAVNRRDASGFGIMQIDKQSNITAFMEKPG
PDKNIDEWKIPAQSGIPVASPDKEYLASMGIYIFNAKAMEDCLNNSMTDFGKEIIPASIK
DHKVSAFVHNGYWEDIGTIRSFYEANLDLTEITPQFNFYDAEAPIYTHYRNLPASKINGA
QLDRVTCSEGCVITYATITRSVIGIRTIIESGSVLEGVVCMGADYYESESSKAGDEKADI
PCVGIGKNCHIKKAIIDKNARIGHNVSIGMGEIPPDGDYGYYHVVDRIYVITKNAIIPDN
TVI
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgccgaaagtattatcgattatcttgggaggcggaaaaggaacccgtttatacccactt
actcaatcccgttcaaagccggccgtaccgttcggagggaaacaccgtatcgtcgacata
cctatctccaactgtatcaattccggtcttagacaaatttatgtattgactcaatttaac
tccgcatcgctgcatctgcacattgcgcgggcataccgctttgacagtttttcaaacggt
tttgtcgaaattcttgctgcagagcaaacgtttgaacattcaggctggtacgaaggtacc
gcggacgcagtaagaaaaaattttacgcactttaaaacgcaagatccgaaatactatatc
atcctttcaggcgatcaattatatcgtatgaatttacaagatttcttagcgcagcacgaa
gcttccggagcagacattaccatcgcctgcacggcggtcaaccgtcgcgacgcttccgga
ttcggtattatgcagatcgataaacaatcgaatatcaccgcttttatggaaaaacccggc
cctgacaaaaatattgacgaatggaagattcctgcacagtcgggtattccggtcgcaagc
cccgataaagaatatctcgcttcgatgggtatttacatctttaatgcaaaggcgatggaa
gactgcttaaacaacagcatgacggacttcggaaaagaaattatccccgcttcgattaaa
gatcataaggtttcggcatttgtgcataacggctattgggaagacatcggtaccattcgc
agcttctacgaagcaaacctcgatttaacggaaattacgccgcagtttaacttttatgat
gcggaagcgccgatttatacccactaccgaaatctgccggcttcaaaaattaatggagcg
cagttggatcgtgttacctgtagtgaaggttgtgttattacctatgcgacaattacccga
tccgtaatcggtattagaaccattatcgaatccggcagcgtattggaaggagttgtctgt
atgggagcggactactacgaatccgaaagcagtaaggcaggagatgaaaaagccgatatt
ccttgtgtcggtatcgggaaaaattgccatattaaaaaagcgattatcgacaaaaatgca
cgaatcgggcataacgtatccatcggtatgggggaaattccgcccgacggcgactacggc
tattatcacgttgttgaccgcatttacgttatcaccaaaaacgcaattatccctgacaac
accgtcatttaa

DBGET integrated database retrieval system