KEGG   Treponema sp. OMZ 804: GWP43_03715
Entry
GWP43_03715       CDS       T06435                                 

Gene name
rpiB
Definition
(GenBank) ribose 5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00030  Pentose phosphate pathway
trz00051  Fructose and mannose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GWP43_03715 (rpiB)
   00051 Fructose and mannose metabolism
    GWP43_03715 (rpiB)
Enzymes [BR:trz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     GWP43_03715 (rpiB)
SSDB
Motif
Pfam: LacAB_rpiB
Other DBs
NCBI-ProteinID: QHX42701
UniProt: A0A6P1XZ42
LinkDB
Position
complement(797654..798106)
AA seq 150 aa
MKVGFGCDHASVGLKHILMEHVRNKGYECVDYGTTDPKVPVDYPEFGLKVAEAIKSKEVE
KGILICGSGIGISLAANKVPGIRAAACSEPCTAKLAVEHSDINIVSMGVCIVGPEIAKAI
VDAFFDAQFEGGSYTKRVNMIGDIEKKYSK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaggtcggttttggatgcgatcatgcatcggttggattaaaacatatcttaatggaa
catgtacgaaacaaagggtatgaatgtgtcgattacggaacaacagatccgaaggttccg
gtcgattatcccgaattcggtttaaaggttgctgaggcaattaaatcgaaggaggttgaa
aaaggaatattgatctgcggatcaggtatcggtatttccctcgccgcaaataaggttccg
ggaatccgcgctgccgcgtgtagtgaaccgtgcaccgcaaaattggctgttgagcacagt
gatatcaatattgtttctatgggggtatgtattgtaggtcctgaaatagcaaaagcaatt
gtcgatgctttttttgatgcacagtttgaaggcggcagctacacaaaacgcgtcaatatg
atcggcgatatagaaaagaagtacagtaaataa

KEGG   Treponema sp. OMZ 804: GWP43_10460
Entry
GWP43_10460       CDS       T06435                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase RpiA
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00030  Pentose phosphate pathway
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GWP43_10460 (rpiA)
Enzymes [BR:trz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     GWP43_10460 (rpiA)
SSDB
Motif
Pfam: Rib_5-P_isom_A
Other DBs
NCBI-ProteinID: QHX43797
UniProt: A0A6P1Y1X0
LinkDB
Position
2234507..2235238
AA seq 243 aa
MSNTISVEDQKILVARTAIDKLISEGLIYSGMKIGLGTGSTAMPAVKRLAEYIAKGKLKN
IAAVPTSFQTSIACEEFNIPIFSLSSGRINGSLDLTIDGADEIDSKKNLTKGGGAALLRE
KIIAYNSELFVVIGDETKSVKTLGVNFPLPIEIVPEARLSIMKKLESYGVSMIIRDGIRK
KGPVITDNGNFIMDIKWPANAKINPVKLESELNAIPGIIENGFFTQKPPRVFLSHSNGTV
EEF
NT seq 732 nt   +upstreamnt  +downstreamnt
atgagtaacacaataagtgttgaagatcagaagatattagttgcccgtactgctatcgat
aaattgatttctgaagggctcatttattccggtatgaagatcggcctcggaaccggctcc
accgcgatgcctgccgtaaaacgcttggctgagtatattgcaaaggggaaattaaaaaac
atcgccgctgtccctaccagttttcaaacatcgatagcgtgtgaggaattcaacattccg
attttttctctcagttcaggacgaattaacggatcgctagacttaacaattgacggggca
gatgaaatcgattcaaaaaagaatcttacgaaaggcgggggtgcagcattgctgcgcgaa
aagattatcgcgtataacagcgaactattcgtggttatcggtgatgaaacaaaaagcgtc
aaaacattaggggtgaattttccgctccctattgaaattgtaccggaagcacggctcagc
attatgaaaaaactggaatcttatggagtctcaatgattatccgcgacggaatccggaaa
aaggggccggttatcaccgataacggaaacttcattatggatataaaatggccggctaat
gcaaaaatcaatcctgtcaaattagaaagcgaattgaatgcaataccgggcattatcgaa
aacggcttctttactcaaaaacccccgcgtgtctttttaagccattcaaacggaaccgtc
gaagaattctaa

DBGET integrated database retrieval system