KEGG   Treponema sp. OMZ 804: GWP43_04365
Entry
GWP43_04365       CDS       T06435                                 

Definition
(GenBank) fructose bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00030  Pentose phosphate pathway
trz00051  Fructose and mannose metabolism
trz00680  Methane metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_04365
   00030 Pentose phosphate pathway
    GWP43_04365
   00051 Fructose and mannose metabolism
    GWP43_04365
  09102 Energy metabolism
   00680 Methane metabolism
    GWP43_04365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:trz04131]
    GWP43_04365
   03036 Chromosome and associated proteins [BR:trz03036]
    GWP43_04365
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_04365
Enzymes [BR:trz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GWP43_04365
Membrane trafficking [BR:trz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GWP43_04365
Chromosome and associated proteins [BR:trz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    GWP43_04365
Exosome [BR:trz04147]
 Exosomal proteins
  Proteins found in most exosomes
   GWP43_04365
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-ProteinID: QHX42805
UniProt: A0A6P1XZK3
LinkDB
Position
930115..931002
AA seq 295 aa
MDKQKIERMHTGKGFIAALDQSGGSTPKALAGYGIGKDAYSNEKEMFDMVHAMRTRIITS
KEFDKKHILGAILFEQTMDRDIEGIPTADYLWDKRGVLPFLKVDKGLADLAEGVQLMKPM
PDLEALLQRAVQKHIFGTKMRSVIKEANPAGIKKVIDQQFEIGLQIAKHGLVPIIEPEVD
IHSPDKSKCEDILKKEIREHIAKLPKDVLIMLKLSIPTQADLYKEFIDNPQVVRVVALSG
GYSREEANALLAKNHGMIASFSRALAEDLRAQQSQEEFDKTLAAAIKSIYDASIT
NT seq 888 nt   +upstreamnt  +downstreamnt
atggacaagcaaaaaatagaacggatgcacaccggaaagggattcatcgcggctttggat
cagagtggtggcagtacgcctaaggctctggccggatacggtatcggaaaagacgcctat
tcaaatgaaaaagagatgtttgatatggtgcatgccatgcgcacgcggattatcaccagt
aaagaattcgacaaaaagcatatactcggtgctatcctttttgagcaaacaatggatcgt
gatatagagggtattcctacggcagactatctgtgggataagcgcggcgttttaccgttt
ctaaaggttgataaaggacttgcagacttagccgaaggtgttcagctgatgaagccgatg
cccgatttggaagcattgctgcaacgtgccgtacagaagcatatcttcgggacaaagatg
cgctcggttataaaggaagcaaatcctgccggtatcaaaaaagttatcgatcagcagttt
gaaatcggtctgcaaattgcaaagcacggattagtaccgattatcgaaccggaagtagat
attcacagccccgataaatcaaagtgtgaagatatcctaaaaaaagaaattcgcgaacac
attgcaaaattgccgaaggatgtgttgattatgctcaagctgagcatcccgacacaggca
gacctgtacaaagaatttatcgacaatccgcaagttgtacgcgttgtcgcactttcgggc
gggtacagtagagaggaagccaatgcgttgctggcaaaaaaccacggtatgatcgccagc
ttctcccgtgccctcgcagaagatttacgtgcacagcagtcgcaagaagaattcgacaaa
acccttgccgctgcaattaagagcatttacgacgcttcgattacatag

DBGET integrated database retrieval system