KEGG   Treponema sp. OMZ 804: GWP43_05245
Entry
GWP43_05245       CDS       T06435                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00071  Fatty acid degradation
trz00280  Valine, leucine and isoleucine degradation
trz00410  beta-Alanine metabolism
trz00640  Propanoate metabolism
trz00650  Butanoate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GWP43_05245
   00650 Butanoate metabolism
    GWP43_05245
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GWP43_05245
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GWP43_05245
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GWP43_05245
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     GWP43_05245
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: QHX42943
UniProt: A0A6P1Y151
LinkDB
Position
1099631..1100773
AA seq 380 aa
MYNFELTDYQKEIRRRAETFAQKELLPGVIERDKTETYDMSIVKKLGEAGLIGLQFDPKY
GGHGNDYLAFLIVVEELCKVDSAFGISYAISSTFTTGIDSFGNEEQKMHCMPRLFAGDAI
GCFALTEPDAGSDAGSAKTQAIRDGDNFILNGKKHYITNSAVADYCMLIANTDLSKGSKG
LTAFLVDMKNTPGISIGHIESKCGIRSAKVAEINIENAVIPASRMIGTEGKGFRYALSAL
NAGRLGVAAQGLGIAQSSFDICKDYMKERMQFGKPIYKNQYLAFKMAELQTEIDMCRLLL
YKGAWEQQQGMDFSISACKAKLACSNLAMKVTTECIQNMGGAGYMRENHVERMFRDAKIT
QVYEGTNEIQRLIISGAIFG
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtataattttgaactgacagactaccagaaagagattcggcggcgtgccgaaacattt
gcgcagaaggaactgcttcccggtgtgatcgagcgagataaaacggaaacgtacgatatg
agtattgtaaaaaaactgggggaggcagggctgatcggcctgcaattcgatccaaagtat
gggggtcacggtaacgattaccttgcgtttctaatcgtggtagaagaattgtgtaaggtg
gattcggccttcggcatttcctatgcaatctcatctacttttacaacgggcatcgactcc
ttcggcaacgaagaacaaaagatgcattgtatgccgcgtctctttgccggagatgcaatc
ggctgctttgcactgacggagccggacgcaggttccgatgcgggttctgctaaaacgcaa
gcgattcgtgatggagataactttattttgaacggcaaaaagcactatattaccaatagt
gccgttgccgactactgtatgctgattgcaaacacagatctttctaagggctcaaagggt
ttgactgccttcctagtagacatgaagaatacgccaggtattagcatcggacatattgaa
agtaagtgtggtatccgttcggccaaggttgcggagatcaacattgaaaacgcagtgatt
cctgcaagccgcatgatcggcacggaggggaagggattccgctatgcactaagcgcgctc
aatgccggcaggctcggtgtagcagcgcaggggctaggcattgcgcagagctcctttgat
atctgcaaagattacatgaaggagcgcatgcagtttggtaaaccaatctataagaaccag
tatctggcttttaagatggccgaactgcaaacggagatcgatatgtgtcgtcttttgctt
tataagggagcatgggaacagcagcagggaatggatttctccatatcggcctgtaaagca
aagcttgcctgctcaaatctggccatgaaggtcaccacggagtgtatccaaaatatgggc
ggggccggatatatgcgcgaaaatcatgtagaacgaatgttccgcgatgcgaagataacc
caggtctacgaaggaacgaatgagatacaaaggctgatcatcagcggcgctatctttggc
tga

KEGG   Treponema sp. OMZ 804: GWP43_10885
Entry
GWP43_10885       CDS       T06435                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00071  Fatty acid degradation
trz00280  Valine, leucine and isoleucine degradation
trz00410  beta-Alanine metabolism
trz00640  Propanoate metabolism
trz00650  Butanoate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GWP43_10885
   00650 Butanoate metabolism
    GWP43_10885
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GWP43_10885
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GWP43_10885
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GWP43_10885
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     GWP43_10885
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M MafB HpaB_N
Other DBs
NCBI-ProteinID: QHX43869
UniProt: A0A6P1Y3A3
LinkDB
Position
complement(2323647..2324819)
AA seq 390 aa
MDFTLSREQLMAQQLFRDFAQNEVKPLAAEVDEEEKFPEENVKKMAKLGFFGIPVPKQYG
GQGADVLTYAMCVEEMSKVCGTTGVIISAHTSLCIDPIMHFGTEAQKMKYVPDLAAGKKI
GAFGLTEPGAGTDAQGQQTTAVLDGDHWVLNGSKIFITNAGYADVFIVIAVTGTVKDKKG
RSMKEISAFIVERGFPGFSIGKHEKKMGIRGSSTCELVFEDCIVPKENLLGVQGRGFIIA
MATLDGGRIGIAAQALGIAEGAIEETIKYTKERVQFGKRISQQQNTQFQLADMAARTQGA
QYLVYAAACKKQAANENPNIRYSVEAAMAKLVAAEVASDVTRRCLQLFGGYGYTRDYPIE
RMMRDAKITEIYEGTSEVQRMVIAGNLGVN
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggattttacgttgagcagagaacagctcatggcgcagcagctgtttcgcgattttgcg
caaaacgaagtaaaaccgctcgctgccgaagtcgacgaagaggaaaaatttcctgaagaa
aatgtcaaaaagatggcaaagctgggattcttcggcattcccgtcccgaaacagtacggc
ggacagggggctgacgttttaacctatgccatgtgtgtggaagaaatgagcaaggtatgc
ggaacaaccggcgttatcatttccgcgcatacttcactgtgtatcgatccgattatgcac
ttcggaacggaagcacaaaagatgaagtatgtacccgatttagccgccggtaaaaagatc
ggtgctttcgggttaaccgaaccgggcgccggaaccgatgctcaaggtcagcagacaacc
gcagtgcttgacggcgatcactgggtgttaaacggcagcaaaatctttatcaccaatgcg
ggctatgccgacgtctttatcgttattgcagtaaccggcacggtaaaagataagaaaggc
cgttctatgaaagaaatcagcgcattcatcgtagaacgaggattccccggtttctccatc
ggtaagcatgaaaagaaaatgggtatccgcggatcttccacctgcgagctggtatttgaa
gactgcatcgtgccgaaagaaaacctcctcggcgtacagggacgcggctttatcatcgct
atggcaacccttgacggcggacgtatcggtatcgcagcacaggcgctcggtattgcggaa
ggcgctatcgaagaaaccatcaaatatacaaaagaacgtgtccagttcggaaagcgcatc
agccagcagcagaacactcagttccagcttgcggatatggcagcccgcactcaaggcgct
cagtatcttgtctatgcggcagcatgcaagaaacaggcagccaacgaaaatcccaatatt
cgttattccgtagaagcggcaatggcaaagctcgttgcggctgaggtcgcaagcgacgta
acccgacgctgtctgcagctcttcggtggatacggctacacccgcgactacccgattgag
cggatgatgcgcgacgcaaagattacggaaatttacgaaggcacgagcgaagttcagcgc
atggttattgccggaaacctcggcgtcaattaa

DBGET integrated database retrieval system